Basic Vector Information
pTn7xT vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pTn7xT vector Sequence
LOCUS Exported 3633 bp ds-DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pTn7xT, complete sequence.
ACCESSION KF813060
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3633)
AUTHORS Bruckbauer ST, Kvitko BH, Karkhoff-Schweizer RR, Schweizer HP.
TITLE Tn5/7-lux: A versatile tool for the identification and capture of
promoters in Gram-negative bacteria
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 3633)
AUTHORS Bruckbauer ST, Kvitko BH, Karkhoff-Schweizer RR, Schweizer HP.
TITLE Direct Submission
JOURNAL Submitted (04-NOV-2013) Microbiology, Immunology and Pathology,
Colorado State University, 2025 Campus Delivery, Fort Collins, CO
80523, USA
REFERENCE 3 (bases 1 to 3633)
AUTHORS .
TITLE Direct Submission
FEATURES Location/Qualifiers
source 1..3633
/organism="Cloning vector pTn7xT"
/lab_host="Escherichia coli"
/mol_type="other DNA"
/db_xref="taxon:1454557"
misc_feature 58..105
/label=FRT site
/note="FRT site"
protein_bind complement(58..105)
/label=FRT
/bound_moiety="FLP recombinase from the Saccharomyces
cerevisiae 2u plasmid"
/note="FLP-mediated recombination occurs in the 8-bp core
sequence TCTAGAAA (Turan and Bode, 2011)."
promoter 157..185
/gene="intI1 (promoter lies within the coding sequence)"
/label=Pc promoter
/note="class 1 integron promoter"
CDS 512..748
/codon_start=1
/gene="dhfRII"
/product="trimethoprim resistant dihydrofolate reductase"
/label=dhfRII
/protein_id="AHH35070.1"
/translation="MGQSSDEANAPVAGQFALPLSATFGLGDRVRKKSGAAWQGQVVGW
YCTKLTPEGYAVESESHPGSVQIYPVAALERVA"
gene 512..748
/gene="dhfRII"
/label=dhfRII
misc_feature 810..857
/label=FRT site
/note="FRT site"
protein_bind complement(810..857)
/label=FRT
/bound_moiety="FLP recombinase from the Saccharomyces
cerevisiae 2u plasmid"
/note="FLP-mediated recombination occurs in the 8-bp core
sequence TCTAGAAA (Turan and Bode, 2011)."
regulatory 898..995
/regulatory_class="terminator"
/note="phage lambda"
terminator 903..989
/gene="Escherichia coli rrnB"
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
regulatory 1092..1186
/regulatory_class="terminator"
/note="Escherichia coli rrnB operon"
terminator 1092..1186
/label=lambda t0 terminator
/note="transcription terminator from phage lambda"
primer_bind complement(1214..1230)
/label=KS primer
/note="common sequencing primer, one of multiple similar
variants"
repeat_region 1235..1433
/note="Tn7R; Tn7 right end"
oriT 2033..2294
oriT 2179..2287
/note="incP origin of transfer"
rep_origin 2318..2699
/label=R6K
/note="R6K"
rep_origin 2338..2694
/label=R6K gamma ori
/note="gamma replication origin from E. coli plasmid R6K;
requires the R6K initiator protein pi for replication"
mobile_element 2910..3075
/mobile_element_type="transposon:Tn7"
/note="mini-Tn7 element (left end of the Tn7 transposon)"
protein_bind 3106..3130
/gene="mutant version of attB"
/label=attB1
/bound_moiety="BP Clonase(TM)"
/note="recombination site for the Gateway(R) BP reaction"
regulatory 3161..3626
/regulatory_class="promoter"
/note="Pseudomonas aeruginosa PA4974 gene"
This page is informational only.