pCB578 vector (Cat. No.: V017331)
Note: E. coli-Lactobacilli shuttle vector featuring SpCas9, tracrRNA, and a repeat-spacer-repeat array, with erythromycin resistance at 200 μg/mL.
- Name:
- pCB578
- Antibiotic Resistance:
- Erythromycin
- Length:
- 11446 bp
- Type:
- Genome editing
- Replication origin:
- ori
- Host:
- Lactobacillus
- Copy Number:
- Low
- Growth Strain(s):
- Stbl3
- Growth Temperature:
- 37℃
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Leenay RT, Vento JM, Shah M, Martino ME, Leulier F, Beisel CL. Genome Editing with CRISPR-Cas9 in Lactobacillus plantarum Revealed That Editing Outcomes Can Vary Across Strains and Between Methods. Biotechnol J. 2019;14(3):e1700583. doi:10.1002/biot.201700583
pCB578 vector (Cat. No.: V017331) Sequence
LOCUS Exported 11446 bp DNA circular SYN 13-SEP-2024
DEFINITION Exported.
ACCESSION V017331
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 11446)
TITLE Direct Submission
REFERENCE 2 (bases 1 to 11446)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..11446
/mol_type="other DNA"
/organism="synthetic DNA construct"
source 279..563
/mol_type="other DNA"
/label=broad host range vector
/note="broad host range vector"
/db_xref="taxon:1265608"
/organism="Shuttle vector pKV12"
source join(564..11446,1..278)
/mol_type="other DNA"
/organism="synthetic DNA construct"
source 899..1228
/mol_type="other DNA"
/label=broad host range vector
/note="broad host range vector"
/db_xref="taxon:1265608"
/organism="Shuttle vector pKV12"
gene 279..563
/gene="copS"
/label=copS
CDS 279..563
/codon_start=1
/transl_table=11
/gene="copS"
/product="copy number repressor"
/label=copS
/protein_id="AFY24252.1"
/translation="MELAFRESLKKMRGTKSKEKFSQELEMSRSNYSRIESGKSDPTIK
TLEQIAKLTNSTLVVDLIPNEPTEPEPETESEQVTLDLEMEEEKSNDFV"
gene 899..1228
/gene="repD"
/label=repD
CDS 899..1228
/codon_start=1
/transl_table=11
/gene="repD"
/product="replication protein RepD"
/label=repD
/protein_id="AFY24251.1"
/translation="MYSFIEGGVCMNHDECKTYIKNSLLEIRKLANIYTLETFKKELEK
RNIYLETKSDKYFSSEGEDYIYKLIENNKIIYSISGKKLTYKGKKSFSKHAILKQLNEK
ANQVN"
CDS 1271..2761
/codon_start=1
/label=RepR
/translation="MNIPFVVETVLHDGLLKYKFKNSKIRSITTKPGKSKGAIFAYRSK
SSMIGGRGVVLTSEEAIQENQDTFTHWTPNVYRYGTYADENRSYTKGHSENNLRQINTF
FIDFDIHTAKETISASDILTTAIDLGFMPTMIIKSDKGYQAYFVLETPVYVTSKSEFKS
VKAAKIISQNIREYFGKSLPVDLTCNHFGIARIPRTDNVEFFDPNYRYSFKEWQDWSFK
QTDNKGLTRSSLTVLSGTEGKKQVDEPWFNLLLHETKFSGEKGLIGRNNVMFTLSLAYF
SSGYSIETCEYNMFEFNNRLDQPLEEKEVIKIVRSAYSENYQGANREYITILCKAWVSS
DLTSKDLFVRQGWFKFKKKRSERQRVHLSEWKEDLMAYISEKSDVYKPYLVTTKKEIRE
VLGIPERTLDKLLKVLKANQEIFFKIKPGRNGGIQLASVKSLLLSIIKVKKEEKESYIK
ALTNSFDLEHTFIQETLNKLAERPKTDTQLDLFSYDTG"
misc_RNA complement(3487..3565)
/label=tracrRNA
/note="trans-activating CRISPR RNA for the Streptococcus
pyogenes CRISPR/Cas9 system"
CDS 3861..7964
/label=Cas9
/note="Cas9 (Csn1) endonuclease from the Streptococcus
pyogenes Type II CRISPR/Cas system"
rep_origin 8509..9097
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
promoter 9355..9373
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
repeat_region 9942..9977
/label=DR
/note="direct repeat for the Streptococcus pyogenes
CRISPR/Cas system"
CDS 10662..11396
/gene="ermBP"
/label=rRNA adenine N-6-methyltransferase
/note="rRNA adenine N-6-methyltransferase from Enterococcus
faecalis. Accession#: P0A4D5"