Basic Vector Information
- Vector Name:
- 5-PLTP-ODP2-OS-T28
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6727 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Gao H.
5-PLTP-ODP2-OS-T28 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
5-PLTP-ODP2-OS-T28 vector Sequence
LOCUS 62056_156 6727 bp DNA circular SYN 19-MAR-2020 DEFINITION Cloning vector 5-PLTP:ODP2:OS-T28, complete sequence. ACCESSION MN294717 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6727) AUTHORS Gao H. TITLE Direct Submission JOURNAL Submitted (08-AUG-2019) Molecular Engineering in AST, Corteva Agriscience, 8305 NW 62nd Ave., Johnston, IA 50131, USA REFERENCE 2 (bases 1 to 6727) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (08-AUG-2019) Molecular Engineering in AST, Corteva Agriscience, 8305 NW 62nd Ave., Johnston, IA 50131, USA" COMMENT ##Assembly-Data-START## Assembly Method :: Vector NTI v. 10 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..6727 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 51..67 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind 83..182 /label=attL1 /note="recombination site for the Gateway(R) LR reaction" regulatory 221..1191 /regulatory_class="promoter" CDS 1285..3417 /codon_start=1 /transl_table=11 /product="ZM-ODP2" /label=ZM-ODP2 /protein_id="QIN53503.1" /translation="MATVNNWLAFSLSPQELPPSQTTDSTLISAATADHVSGDVCFNIP QDWSMRGSELSALVAEPKLEDFLGGISFSEQHHKANCNMIPSTSSTVCYASSGASTGYH HQLYHQPTSSALHFADSVMVASSAGVHDGGAMLSAAAANGVAGAASANGGGIGLSMIKN WLRSQPAPMQPRVAAAEGAQGLSLSMNMAGTTQGAAGMPLLAGERARAPESVSTSAQGG AVVVTAPKEDSGGSGVAGALVAVSTDTGGSGGASADNTARKTVDTFGQRTSIYRGVTRH RWTGRYEAHLWDNSCRREGQTRKGRQVYLGGYDKEEKAARAYDLAALKYWGATTTTNFP VSNYEKELEDMKHMTRQEFVASLRRKSSGFSRGASIYRGVTRHHQHGRWQARIGRVAGN KDLYLGTFSTQEEAAEAYDIAAIKFRGLNAVTNFDMSRYDVKSILDSSALPIGSAAKRL KEAEAAASAQHHHAGVVSYDVGRIASQLGDGGALAAAYGAHYHGAAWPTIAFQPGAAST GLYHPYAQQPMRGGGWCKQEQDHAVIAAAHSLQDLHHLNLGAAGAHDFFSAGQQAAAAA MHGLGSIDSASLEHSTGSNSVVYNGGVGDSNGASAVGGSGGGYMMPMSAAGATTTSAMV SHEQVHARAYDEAKQAAQMGYESYLVNAENNGGGRMSAWGTVVSAAAAAAASSNDNMAA DVGHGGAQLFSVWNDT" regulatory 3435..4315 /regulatory_class="terminator" protein_bind complement(4366..4465) /label=attL2 /note="recombination site for the Gateway(R) LR reaction" promoter complement(4483..4501) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(4506..4522) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 4635..5441 /label=KanR /note="aminoglycoside phosphotransferase" rep_origin 5591..6179 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(6509..6536) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(6628..6714) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.