Basic Vector Information
- Vector Name:
- 5-PLTP-ODP2-OS-T28
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6727 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Gao H.
5-PLTP-ODP2-OS-T28 vector Vector Map
5-PLTP-ODP2-OS-T28 vector Sequence
LOCUS 62056_156 6727 bp DNA circular SYN 19-MAR-2020 DEFINITION Cloning vector 5-PLTP:ODP2:OS-T28, complete sequence. ACCESSION MN294717 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6727) AUTHORS Gao H. TITLE Direct Submission JOURNAL Submitted (08-AUG-2019) Molecular Engineering in AST, Corteva Agriscience, 8305 NW 62nd Ave., Johnston, IA 50131, USA REFERENCE 2 (bases 1 to 6727) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (08-AUG-2019) Molecular Engineering in AST, Corteva Agriscience, 8305 NW 62nd Ave., Johnston, IA 50131, USA" COMMENT ##Assembly-Data-START## Assembly Method :: Vector NTI v. 10 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..6727 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 51..67 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind 83..182 /label=attL1 /note="recombination site for the Gateway(R) LR reaction" regulatory 221..1191 /regulatory_class="promoter" CDS 1285..3417 /codon_start=1 /transl_table=11 /product="ZM-ODP2" /label=ZM-ODP2 /protein_id="QIN53503.1" /translation="MATVNNWLAFSLSPQELPPSQTTDSTLISAATADHVSGDVCFNIP QDWSMRGSELSALVAEPKLEDFLGGISFSEQHHKANCNMIPSTSSTVCYASSGASTGYH HQLYHQPTSSALHFADSVMVASSAGVHDGGAMLSAAAANGVAGAASANGGGIGLSMIKN WLRSQPAPMQPRVAAAEGAQGLSLSMNMAGTTQGAAGMPLLAGERARAPESVSTSAQGG AVVVTAPKEDSGGSGVAGALVAVSTDTGGSGGASADNTARKTVDTFGQRTSIYRGVTRH RWTGRYEAHLWDNSCRREGQTRKGRQVYLGGYDKEEKAARAYDLAALKYWGATTTTNFP VSNYEKELEDMKHMTRQEFVASLRRKSSGFSRGASIYRGVTRHHQHGRWQARIGRVAGN KDLYLGTFSTQEEAAEAYDIAAIKFRGLNAVTNFDMSRYDVKSILDSSALPIGSAAKRL KEAEAAASAQHHHAGVVSYDVGRIASQLGDGGALAAAYGAHYHGAAWPTIAFQPGAAST GLYHPYAQQPMRGGGWCKQEQDHAVIAAAHSLQDLHHLNLGAAGAHDFFSAGQQAAAAA MHGLGSIDSASLEHSTGSNSVVYNGGVGDSNGASAVGGSGGGYMMPMSAAGATTTSAMV SHEQVHARAYDEAKQAAQMGYESYLVNAENNGGGRMSAWGTVVSAAAAAAASSNDNMAA DVGHGGAQLFSVWNDT" regulatory 3435..4315 /regulatory_class="terminator" protein_bind complement(4366..4465) /label=attL2 /note="recombination site for the Gateway(R) LR reaction" promoter complement(4483..4501) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(4506..4522) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 4635..5441 /label=KanR /note="aminoglycoside phosphotransferase" rep_origin 5591..6179 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(6509..6536) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(6628..6714) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.