pCMA vector (V016512)

LOCUS       62056_6530        3893 bp DNA     circular SYN 20-AUG-2019
DEFINITION  Transformation vector pCMA, complete sequence.
ACCESSION   MN177722
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3893)
  AUTHORS   LaBrie SD, Dimond ZE, Harrison KS, Baid S, Wickstrum J, Suchland RJ,
            Hefty PS.
  TITLE     Transposon Mutagenesis in Chlamydia trachomatis Identifies CT339 as 
            a ComEC Homolog Important for DNA Uptake and Lateral Gene Transfer
  JOURNAL   MBio 10 (4), e01343-19 (2019)
  PUBMED    31387908
REFERENCE   2  (bases 1 to 3893)
  AUTHORS   Dimond ZE, LaBrie SD, Wickstrum J, Hefty PS.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUL-2019) Molecular Biosciences, University of Kansas,
            2034 Haworth Hall 1200 Sunnyside Avenue, Lawrence, KS 66045, USA
REFERENCE   3  (bases 1 to 3893)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "MBio"; 
            date: "2019"; volume: "10"; issue: "4"; pages: "e01343-19"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (15-JUL-2019) Molecular Biosciences, University of Kansas, 2034 
            Haworth Hall 1200 Sunnyside Avenue, Lawrence, KS 66045, USA"
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Velvet v. 1.2.10
            Assembly Name         :: pCMA5M
            Coverage              :: >50x
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..3893
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    264..285
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        300..330
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    338..354
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     362..378
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     repeat_region   395..423
                     /rpt_family="Himar repeat"
     CDS             complement(567..1424)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(1425..1529)
                     /label=AmpR promoter
     repeat_region   1791..1819
                     /rpt_family="Himar repeat"
     regulatory      1996..2024
                     /label=CT559 promoter
                     /note="CT559 promoter"
                     /regulatory_class="promoter"
     CDS             2046..3092
                     /codon_start=1
                     /transl_table=11
                     /product="Himar C9 transposase"
                     /label=Himar C9 transposase
                     /protein_id="QED88327.1"
                     /translation="MEKKEFRVLIKYCFLKGKNTVEAKTWLDNEFPDSAPGKSTIIDWY
                     AKFKRGEMSTEDGERSGRPKEVVTDENIKKIHKMILNDRKMKLIEIAEALKISKERVGH
                     IIHQYLDMRKLCAKWVPRELTFDQKQRRVDDSKRCLQLLTRNTPEFFRRYVTMDETWLH
                     HYTPESNRQSAEWTATGEPSPKRGKTQKSAGKVMASVFWDAHGIIFIDYLEKGKTINSD
                     YYMALLERLKVEIAAKRPHMKKKKVLFHQDNAPCHKSLRTMAKIHELGFELLPHPPYSP
                     DLAPSDFFLFSDLKRMLAGKKFGCNEEVIAETEAYFEAKPKEYYQNGIKKLEGRYNRCI
                     ALEGNYVE"
     rep_origin      3281..3869
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"