Basic Vector Information
- Vector Name:
- pCI-7608NS1-Gluc1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4986 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Declercq M, Biquand E, Karim M, Pietrosemoli N
- Promoter:
- CMV
pCI-7608NS1-Gluc1 vector Map
pCI-7608NS1-Gluc1 vector Sequence
LOCUS 62056_6365 4986 bp DNA circular SYN 28-OCT-2020
DEFINITION Cloning vector pCI-7608NS1-Gluc1, complete sequence.
ACCESSION MT966974
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4986)
AUTHORS Declercq M, Biquand E, Karim M, Pietrosemoli N, Jacob Y, Demeret C,
Barbezange C, van der Werf S.
TITLE Influenza A virus co-opts ERI1 exonuclease bound to histone mRNA to
promote viral transcription
JOURNAL Nucleic Acids Res 48 (18), 10428-10440 (2020)
PUBMED 32960265
REFERENCE 2 (bases 1 to 4986)
AUTHORS Declercq M, Biquand E, Demeret C, Karim M, Pietrosemoli N, Jacob Y,
Demeret C, Van der Werf S, Barbezange C.
TITLE Direct Submission
JOURNAL Submitted (03-SEP-2020) National Influenza Centre, Sciensano, Rue
Juliette Wytsman 14, Brussels 1180, Belgium
REFERENCE 3 (bases 1 to 4986)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic
Acids Res"; date: "2020"; volume: "48"; issue: "18"; pages:
"10428-10440"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(03-SEP-2020) National Influenza Centre, Sciensano, Rue Juliette
Wytsman 14, Brussels 1180, Belgium"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..4986
/mol_type="other DNA"
/organism="synthetic DNA construct"
enhancer 139..517
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
promoter 518..721
/label=CMV promoter
/note="human cytomegalovirus (CMV) immediate early
promoter"
intron 857..989
/label=chimeric intron
/note="chimera between introns from human beta-globin and
immunoglobulin heavy chain genes"
misc_feature 1012..1027
/label=sequencing primer
/note="sequencing primer"
promoter 1034..1052
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
CDS 1067..2041
/codon_start=1
/transl_table=11
/product="7608NS1-Gluc1"
/label=7608NS1-Gluc1
/note="Influenza virus A/Bretagne/7608/2009 NS1 protein
fused to Gaussia luciferase domain 1"
/protein_id="QOQ50703.1"
/translation="MDSNTMSSFQVDCFLWHIRKRFADNGLGDAPFLDRLRRDQKSLKG
RGNTLGLDIETATLVGKQIVEWILKEESSETLRMTIASVPTSRYLSDMTLEEMSRDWFM
LMPRQKIIGPLCVRLDQAVMEKNIVLKANFSVIFNRLETLILLRAFTEEGAIVGEISPL
PSLPGHTYEDVKNAVGVLIGGLEWNGNTVRVSENIQRFAWRNCDENGRPSLPPEQKAAA
GGGGSGGGGSKPTENNEDFNIVAVASNFATTDLDADRGKLPGKKLPLEVLKEMEANARK
AGCTRGCLICLSHIKCTPKMKKFIPGRCHTYEGDKESAQGGIG"
misc_feature 1067..1723
/label=Influenza virus A/Bretagne/7608/2009 NS1 protein
/note="Influenza virus A/Bretagne/7608/2009 NS1 protein"
misc_feature 1567
/label=mutation A>C in splicing site
/note="mutation A>C in splicing site"
misc_feature 1724..1762
/label=linker
/note="linker"
misc_feature 1763..2044
/label=Gaussia luciferase domain 1
/note="Gaussia luciferase domain 1"
polyA_signal complement(2100..2221)
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
rep_origin 2402..2857
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 3189..3293
/label=AmpR promoter
CDS 3294..4151
/label=AmpR
/note="beta-lactamase"
rep_origin 4325..4913
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.