p15Tc-litR vector (V016431)

LOCUS       62056_1880        5337 bp DNA     circular SYN 31-OCT-2021
DEFINITION  Expression vector p15Tc-litR, complete sequence.
ACCESSION   MZ683493
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5337)
  AUTHORS   Bazhenov S, Melkina O, Fomin V, Scheglova E, Krasnik P, Khrulnova S,
            Zavilgelsky G, Manukhov I.
  TITLE     LitR directly upregulates autoinducer synthesis and luminescence in 
            Aliivibrio logei
  JOURNAL   PeerJ 9, e12030 (2021)
  PUBMED    34616599
REFERENCE   2  (bases 1 to 5337)
  AUTHORS   Bazhenov SV, Manukhov IV.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-AUG-2021) Laboratory for Molecular Genetics, Moscow 
            Institute of Physics and Technology, Pervomayskaya, 3, Dolgoprudny, 
            Moscow Region 141701, Russia
REFERENCE   3  (bases 1 to 5337)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "PeerJ 9, 
            e12030 (2021)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (02-AUG-2021) Laboratory for Molecular Genetics, Moscow Institute of
            Physics and Technology, Pervomayskaya, 3, Dolgoprudny, Moscow Region
            141701, Russia"
FEATURES             Location/Qualifiers
     source          1..5337
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     19..39
                     /label=Ptac sequencing primer
                     /note="Ptac sequencing primer"
     promoter        183..211
                     /label=tac promoter
                     /note="strong E. coli promoter; hybrid between the trp and
                     lac UV5 promoters"
     protein_bind    219..235
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     gene            258..863
                     /gene="litR"
                     /label=litR
                     /note="derived from Aliivibrio logei"
     CDS             258..863
                     /codon_start=1
                     /transl_table=11
                     /gene="litR"
                     /product="LitR family transcriptional regulator"
                     /label=litR
                     /protein_id="UDM84365.1"
                     /translation="METIQKRPRTRLSPEKRKEQLLDIAIEVFSQRGIGRGGHADIAEI
                     AQVSVATVFNYFPTREDLVDDVLNRVEEQFHNFILNSISLDRDVRSNLHSLLVNIIDTV
                     QMDNKWIKVWFEWSTSTREEVWPLFLSTQVNNQKVIHDMFAEGIERNEVCNDHTPENLA
                     KMLHGICYSVFIQANRNSSYEELEQTANCFLNMLCIYK"
     rep_origin      complement(1278..1823)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     promoter        1935..1963
                     /label=tet promoter
                     /note="E. coli promoter for tetracycline efflux protein
                     gene"
     CDS             2011..3198
                     /label=TcR
                     /note="tetracycline efflux protein"
     promoter        3608..3685
                     /label=lacIq promoter
                     /note="In the lacIq allele, a single base change in the
                     promoter boosts expression of the lacI gene about 10-fold."
     CDS             3686..4765
                     /label=lacI
                     /note="lac repressor"
     protein_bind    4781..4802
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        4817..4847
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     CDS             4891..5064
                     /label=lacZ-alpha
                     /note="LacZ-alpha fragment of beta-galactosidase"