Basic Vector Information
- Vector Name:
- CelR_HTK
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3771 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Rondon RE, Groseclose TM, Short AE, Wilson CJ.
CelR_HTK vector Map
CelR_HTK vector Sequence
LOCUS 62056_501 3771 bp DNA circular SYN 03-DEC-2019
DEFINITION Cloning vector CelR_HTK, complete sequence.
ACCESSION MN207914
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3771)
AUTHORS Rondon RE, Groseclose TM, Short AE, Wilson CJ.
TITLE Transcriptional programming using engineered systems of
transcription factors and genetic architectures
JOURNAL Nat Commun 10 (1), 4784 (2019)
PUBMED 31636266
REFERENCE 2 (bases 1 to 3771)
AUTHORS Rondon RE, Groseclose T, Short A, Wilson CJ.
TITLE Direct Submission
JOURNAL Submitted (21-JUL-2019) Chemical and Biomolecular Engineering,
Georgia Institute of Technology, 950 Atlantic dr. NW, 5110E,
Atlanta, GA 30332, United States
REFERENCE 3 (bases 1 to 3771)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat
Commun"; date: "2019"; volume: "10"; issue: "1"; pages: "4784"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(21-JUL-2019) Chemical and Biomolecular Engineering, Georgia
Institute of Technology, 950 Atlantic dr. NW, 5110E, Atlanta, GA
30332, United States"
FEATURES Location/Qualifiers
source 1..3771
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 596..673
/label=lacI promoter
CDS 674..1687
/codon_start=1
/transl_table=11
/product="CelR HTK"
/label=CelR HTK
/protein_id="QFU95493.1"
/translation="MKPVTLYDVAEYAGVSHTTVSKVVNQASHVSAKTREKVEAAIKEL
GYVPNRAARTLVTRRTDTVALVVSENNQKLFAEPFYAGIVLGVGVALSERGFQFVLATG
RSGIEHERLGGYLAGQHVDGVLLLSLHRDDPLPQMLDEAGVPYVYGGRPLGVPEEQVSY
VDIDNIGGGRQATQRLIETGHRRIATIAGPQDMVAGVERLQGYREALLAAGMEYDETLV
SYGDFTYDSGVAAMRELLDRAPDVDAVFAASDLMGLAALRVLRASGRRVPEDVAVVGYD
DSTVAEHAEPPMTSVNQPTELMGREMARLLVDRITGETTEPVRLVLETHLMVRESG"
protein_bind 1727..1748
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin 1939..2483
/label=p15A ori
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."
promoter 3009..3111
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
CDS 3112..3768
/label=CmR
/note="chloramphenicol acetyltransferase"
This page is informational only.