pNRVL-caSAT1-GFP vector (V016365)

MSDS

Basic Vector Information

Vector Name:: pNRVL-caSAT1-GFP

Antibiotic Resistance:: Kanamycin

Length:: 7111 bp

Type:: Expression vector

Replication origin:: ori

Source/Author:: Nemeth T.

pNRVL-caSAT1-GFP vector Vector Map

View Map in NovoBuilder

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pNRVL-caSAT1-GFP vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       62056_18215        7111 bp DNA     circular SYN 03-MAR-2020
DEFINITION  Expression vector pNRVL-caSAT1-GFP, complete sequence.
ACCESSION   MT001912
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7111)
  AUTHORS   Nemeth T.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JAN-2020) Department of Microbiology, University of 
            Szeged, Kozep fasor 52, Szeged, Csongrad 6726, Hungary
REFERENCE   2  (bases 1 to 7111)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Submitted 
            (28-JAN-2020) Department of Microbiology, University of Szeged, 
            Kozep fasor 52, Szeged, Csongrad 6726, Hungary"
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: CLC Genomics Workbench v. v11
            Sequencing Technology :: IonTorrent
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7111
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     terminator      complement(268..295)
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     terminator      complement(387..473)
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     primer_bind     537..553
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    570..575
                     /label=StuI site for cassette release
                     /note="StuI site for cassette release"
     misc_feature    576..1039
                     /note="site of recombination; CpNEUT5LUpup from C.
                     parapsilosis"
     regulatory      1094..1591
                     /label=Candida albicans ACT1 promoter
                     /note="Candida albicans ACT1 promoter"
                     /regulatory_class="promoter"
     gene            1592..2818
                     /gene="caSAT1"
                     /label=caSAT1
     CDS             join(1592..1601,2256..2818)
                     /codon_start=1
                     /transl_table=11
                     /gene="caSAT1"
                     /product="streptothricin acetyltransferase"
                     /label=caSAT1
                     /note="codon-optimized for Candida albicans"
                     /protein_id="QID92297.1"
                     /translation="MDGEEVAALVIDNGSHMKISVIPEQVAETLDAENHFIVREVFDVH
                     LSDQGFELSTRSVSPYRKDYISDDDSDEDSACYGAFIDQELVGKIELNSTWNDLASIEH
                     IVVSHTHRGKGVAHSLIEFAKKWALSRQLLGIRLETQTNNVPACNLYAKCGFTLGGIDL
                     FTYKTRPQVSNETAMYWYWFSGAQDDA"
     regulatory      2822..2951
                     /label=Candida albicans URA3 terminator
                     /note="Candida albicans URA3 terminator"
                     /regulatory_class="terminator"
     regulatory      complement(2999..3239)
                     /label=Saccharomyces cerevisiae URA3 terminator
                     /note="Saccharomyces cerevisiae URA3 terminator"
                     /regulatory_class="terminator"
     protein_bind    3260..3284
                     /label=attB2
                     /note="recombination site for the Gateway(R) BP reaction"
     CDS             complement(3288..4001)
                     /label=yeGFP
                     /note="yeast-enhanced green fluorescent protein"
     protein_bind    complement(4002..4026)
                     /label=attB1
                     /note="recombination site for the Gateway(R) BP reaction"
     regulatory      complement(4033..4882)
                     /label=Candida albicans TDH3 promoter
                     /note="Candida albicans TDH3 promoter"
                     /regulatory_class="promoter"
     misc_feature    4889..5339
                     /note="site of recombination; CpNEUT5LDowndown from C. 
                     parapsilosis"
     misc_feature    5340..5345
                     /label=StuI site for cassette release
                     /note="StuI site for cassette release"
     promoter        complement(5353..5371)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(5376..5392)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             5505..6311
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     rep_origin      6461..7049
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"

This page is informational only.