pLM459-mTurquoise2 vector (V016340)

LOCUS       62056_14350        4680 bp DNA     circular SYN 28-MAR-2021
DEFINITION  Cloning vector pLM459-mTurquoise2, complete sequence.
ACCESSION   MT737964
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4680)
  AUTHORS   Emrich-Mills TZ, Yates G, Barrett J, Grouneva I, Lau CS, Walker CE, 
            Kwok TK, Davey JW, Johnson MP, Mackinder LCM.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JUL-2020) Molecular Biology and Biotechnology, 
            University of Sheffield, Western Bank, Sheffield, South Yorkshire 
            S10 2TN, United Kingdom
REFERENCE   2  (bases 1 to 4680)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Submitted 
            (08-JUL-2020) Molecular Biology and Biotechnology, University of 
            Sheffield, Western Bank, Sheffield, South Yorkshire S10 2TN, United 
            Kingdom"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..4680
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             28..744
                     /label=mTurquoise2
                     /note="enhanced monomeric variant of CFP (Goedhart et al., 
                     2012)"
     CDS             754..780
                     /label=HA
                     /note="HA (human influenza hemagglutinin) epitope tag"
     CDS             784..810
                     /label=HA
                     /note="HA (human influenza hemagglutinin) epitope tag"
     CDS             814..840
                     /label=HA
                     /note="HA (human influenza hemagglutinin) epitope tag"
     CDS             join(1583..1750,1896..2108)
                     /codon_start=1
                     /transl_table=11
                     /product="Ble"
                     /label=Ble
                     /note="zeocin resistance marker"
                     /protein_id="QTE34489.1"
                     /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD
                     VTLFISAVQDQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPW
                     GREFALRDPAGNCVHFVAEEQD"
     rep_origin      2417..2962
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     CDS             complement(3061..3873)
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     CDS             4323..4625
                     /label=ccdB
                     /note="CcdB, a bacterial toxin that poisons DNA gyrase"