Basic Vector Information
- Vector Name:
- pMDE7
- Length:
- 9703 bp
- Type:
- Mutator vector
- Replication origin:
- ori
- Source/Author:
- Sekurova ON, Sun YQ, Zehl M, Ruckert C
pMDE7 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMDE7 vector Sequence
LOCUS 62056_16695 9703 bp DNA circular SYN 19-JUL-2021 DEFINITION Mutator vector pMDE7, complete sequence. ACCESSION MW810320 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9703) AUTHORS Sekurova ON, Sun YQ, Zehl M, Ruckert C, Stich A, Busche T, Kalinowski J, Zotchev SB. TITLE Coupling of the engineered DNA 'mutator' to a biosensor as a new paradigm for activation of silent biosynthetic gene clusters in Streptomyces JOURNAL Nucleic Acids Res. (2021) In press PUBMED 34197612 REFERENCE 2 (bases 1 to 9703) AUTHORS Sekurova ON, Sun Y-Q., Zehl M, Ruckert C, Stich A, Busche T, Kalinowski J, Zotchev SB. TITLE Direct Submission JOURNAL Submitted (09-MAR-2021) CeBiTec, Bielefeld University, Universitaetsstr. 27, Bielefeld, NRW 33615, Germany REFERENCE 3 (bases 1 to 9703) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic Acids Res. (2021) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (09-MAR-2021) CeBiTec, Bielefeld University, Universitaetsstr. 27, Bielefeld, NRW 33615, Germany" COMMENT ##Assembly-Data-START## Assembly Method :: canu v. 2.1.1 Sequencing Technology :: Illumina; ONT ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..9703 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 1..40 /regulatory_class="promoter" gene 99..3638 /gene="dnaE1" /label=dnaE1 CDS 99..3638 /codon_start=1 /transl_table=11 /gene="dnaE1" /product="DnaE1" /label=dnaE1 /protein_id="QXN60066.1" /translation="MSKPPFTHLHVHTQYSLLNGAARLKDMFDACNEMGMSHIAMSDHG NLHGAYDFFHSAKKAGVTPIIGIEAYVAPESRRNKRKIQWGQPHQKRDDVSGSGGYTHK TMWATNSKGLHNLFRLSSDAYAEGWLQKWPRMDKETISQWSEGIVASTGGPSGEVQTRL RLGHFDEALKAAADYQDIFGKDRYFLELMDHGIEIEHRVRDGLLEIGRKLGIPPLVTND SHYTYAHEATAHDALLCIQTGKNLSDPDRFRFDGTGYYLKSTDEMYAIDSSDAWQEGCA NTRLIAEMIDTTGMFEKRDLMPKFDIPEGFTEITWFQEEVRRGMERRFPGGVPEDRQKQ AEYEMDVIIQMGFPGYFLVVADFIMWAKNQGIAVGPGRGSAAGSIVAYAMGITDLDPIP HGLIFERFLNPERVSMPDVDIDFDERRRVEVIRYVTEKYGADKVAMIGTYGKIKAKNAI KDSARVLGYPYAMGDRLTKAMPADVLGKGIDLNGITDPTHPRYSEAGEIRSMYESEPDV KKVIDTAKGVEGLVRQMGVHAAGVIMSSEPIVDHAPIWVRHTDGVTITQWDYPQCESLG LLKMDFLGLRNLTIMDDAVKMVKSNKGIDLDLLSLPLDDPTTFELLQRGDTLGVFQFDG GPMRSLLRLMKPDNFEDISAVSALYRPGPMGMDSHTNYALRKNGLQEITPIHKELEEPL QEVLAVTYGLIVYQEQVQKAAQIIAGYSLGEADILRRVMGKKKPDELAKNFVLFQAGAR KNGYSDEAIQALWDVLVPFAGYAFNKAHSAAYGLVSYWTGYLKANYPAEYMAALLTSVK DDKDKSAVYLNECRRMGIKVLPPNVNESMSNFAAQGDDVILFGLSAVRNVGTNVVESII KCRKAKGKYASFPDYLDKVEAVVCNKRTTESLIKAGAFDEMGHTRKGLTAQYEPMIDNV VAVKRKEAEGQFDLFGGMGDEQSDEPGFGLDVVFGEDEWDKTYLLAQEREMLGLYVSDH PLFGLEHVLSDKADAGISQLTGGDFGDGAVVTIGGIISGLQRKMTKQGNAWAIATVEDL AGSLECMFFPATYQLVSTQLVEDAVVFVKGRLDKREDVPRLVAMELMIPDLSNAGTNAP VVLTIPATRITPPMVSRLGEILTHHRGDSEVRIKLQGPTKTTVLRLDRHRVKPDPALFG DLKVLLGPSCLAG" gene complement(3758..3770) /gene="lacZa'" /label=lacZa' /note="lacZ alpha peptide" primer_bind complement(3771..3787) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(3795..3811) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(3819..3849) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(3864..3885) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4173..4761) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 4948..5943 /gene="hyg" /label=hyg /note="Hygromycin-B 7''-O-kinase from Streptomyces hygroscopicus. Accession#: P09979" oriT 6240..6349 /label=oriT /note="incP origin of transfer" CDS 6382..6750 /label=traJ /note="oriT-recognizing protein" rep_origin complement(7407..8810) /direction=LEFT /label=minimal SCP2* replicon /note="minimal SCP2* replicon" primer_bind 9521..9537 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants"
This page is informational only.