Basic Vector Information
- Vector Name:
- pTRV-RNA2
- Antibiotic Resistance:
- Kanamycin
- Length:
- 8928 bp
- Type:
- VIGS vector
- Replication origin:
- ori
- Source/Author:
- Rahman J, Baldwin IT, Gase K.
pTRV-RNA2 vector Map
pTRV-RNA2 vector Sequence
LOCUS 62056_21570 8928 bp DNA circular SYN 23-NOV-2021
DEFINITION VIGS vector pTRV-RNA2, complete sequence.
ACCESSION MH625696
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 8928)
AUTHORS Rahman J, Baldwin IT, Gase K.
TITLE California TRV-based VIGS vectors mediate gene silencing at elevated
temperatures but with greater growth stunting
JOURNAL BMC Plant Biol 21, 553 (2021)
REFERENCE 2 (bases 1 to 8928)
AUTHORS Rahman J, Gase K, Baldwin IT.
TITLE Direct Submission
JOURNAL Submitted (13-JUL-2018) Molecular Ecology, Max-Planck-Institute for
Chemical Ecology, Hans-Knoell-Strasse 8, Jena, Thueringen 07745,
Germany
REFERENCE 3 (bases 1 to 8928)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "BMC Plant
Biol 21, 553 (2021)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(13-JUL-2018) Molecular Ecology, Max-Planck-Institute for Chemical
Ecology, Hans-Knoell-Strasse 8, Jena, Thueringen 07745, Germany"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..8928
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 201..546
/label=CaMV 35S promoter
/note="strong constitutive promoter from cauliflower mosaic
virus"
misc_feature 568..1728
/note="Tobacco rattle virus California isolate segment
RNA2"
CDS 1090..1692
/codon_start=1
/transl_table=11
/product="coat protein"
/label=coat protein
/protein_id="QDJ00478.1"
/translation="MTDGMYDEEFDSKALNETFSPWVEEKNWKDVLMRLSAMKFALQAD
RDKIPGVLSDLRKDCPFSAFKRFPDKEMWSKLTKEAVIALAQIQAASSFKRRADEKNAV
SGLITATPAQASTSNANPSGSATTVVRPPRLDDSSFQEDSFSFGKFDDASTAYHKALSY
LEGLNLKPLYRRQFEKSYNTRWVPAAAPVAPGPRPNP"
misc_feature 1729..1759
/label=polylinker
/note="polylinker"
misc_feature 1760..2327
/note="Tobacco rattle virus California isolate segment
RNA2"
polyA_signal 2337..2511
/label=CaMV poly(A) signal
/note="cauliflower mosaic virus polyadenylation signal"
misc_feature complement(2594..2618)
/label=LB T-DNA repeat
/note="left border repeat from nopaline C58 T-DNA"
CDS complement(2871..3662)
/label=NeoR/KanR
/note="aminoglycoside phosphotransferase"
CDS 5072..5698
/label=pVS1 StaA
/note="stability protein from the Pseudomonas plasmid pVS1
(Heeb et al., 2000)"
CDS 6130..7200
/label=pVS1 RepA
/note="replication protein from the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
rep_origin 7269..7463
/label=pVS1 oriV
/note="origin of replication for the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
rep_origin complement(7906..8494)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature complement(8851..8875)
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
This page is informational only.