Basic Vector Information
- Vector Name:
- pNATX13-hmtC
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6033 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Chi Z, Chi Z, Kong C.
pNATX13-hmtC vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNATX13-hmtC vector Sequence
LOCUS 62056_17720 6033 bp RNA circular SYN 30-AUG-2020 DEFINITION Shuttle vector pNATX13-hmtC, complete sequence. ACCESSION MT881545 VERSION . KEYWORDS . SOURCE ORGANISM REFERENCE 1 (bases 1 to 6033) AUTHORS Chi Z, Chi Z, Kong C. TITLE Direct Submission JOURNAL Submitted (30-JUL-2020) Ocean University of China, Qing Dao, Shandong 266000, China REFERENCE 2 (bases 1 to 6033) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (30-JUL-2020) Ocean University of China, Qing Dao, Shandong 266000, China" FEATURES Location/Qualifiers source 1..6033 /mol_type="other DNA" promoter 96..200 /label=AmpR promoter CDS 201..1058 /label=AmpR /note="beta-lactamase" rep_origin 1232..1820 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 2108..2129 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 2144..2174 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 2182..2198 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 2206..2222 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" gene 3101..3745 /gene="hmtC" /label=hmtC CDS 3101..3745 /codon_start=1 /transl_table=11 /gene="hmtC" /product="piperazate synthase" /label=hmtC /protein_id="QNJ99249.1" /translation="MFVPSHYREPDSSWMVDIIRGNPLALMMSNGAAGEPPFATHLPVI PDPAMTGDWSERLSEATLLGHMNRDNPQWQALEDGAVVRIAFSGPHAYVSPTLYGVTPA APTWNFTSVHVRGVVERIPSTEETLEVVKSTVRAFEADFGEGWDMAASIDYFRKIVPGV GAFRIMVRNVDGMFKLSQEQQPEVRDRVRKSFAGRECGRHQETAAYMSRLP" protein_bind complement(3752..3785) /label=lox71 /note="Left element (LE) mutant of loxP (Araki et al., 2010). Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." polyA_signal complement(3796..3970) /label=CaMV poly(A) signal /note="cauliflower mosaic virus polyadenylation signal" CDS complement(4014..4580) /label=NrsR /note="nourseothricin acetyltransferase" protein_bind complement(5027..5060) /label=lox66 /note="Right element (RE) mutant of loxP (Araki et al., 2010). Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." primer_bind complement(5639..5655) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants"
This page is informational only.