pLPV3Z vector (V015985)

LOCUS       62056_14370        5523 bp DNA     circular SYN 20-JUL-2019
DEFINITION  Shuttle vector pLPV3Z, complete sequence.
ACCESSION   MK681508
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5523)
  AUTHORS   Visca P.
  TITLE     New shuttle vectors for real-time gene expression analysis in 
            multidrug-resistant Acinetobacter species: in vitro and in vivo 
            applications
  JOURNAL   Appl. Environ. Microbiol. (2019) In press
REFERENCE   2  (bases 1 to 5523)
  AUTHORS   Lucidi M, Prencipe E, Visca P.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-MAR-2019) Department of Science, Roma Tre University, 
            Viale Marconi 446, Rome, Roma 00146, Italia
REFERENCE   3  (bases 1 to 5523)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Appl. 
            Environ. Microbiol. (2019) In press"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (23-MAR-2019) Department of Science, Roma Tre University, Viale 
            Marconi 446, Rome, Roma 00146, Italia"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..5523
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      194..782
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     promoter        974..992
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     1022..1038
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     primer_bind     complement(1072..1088)
                     /label=SK primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    1097..1107
                     /label=stop codons in all the three reading frames
                     /note="stop codons in all the three reading frames"
     regulatory      1110..1121
                     /label=optimized RBS
                     /note="optimized RBS"
                     /regulatory_class="ribosome_binding_site"
     CDS             1128..1841
                     /label=yeGFP
                     /note="yeast-enhanced green fluorescent protein"
     terminator      1864..1958
                     /label=lambda t0 terminator
                     /note="transcription terminator from phage lambda"
     regulatory      2076..2104
                     /label=ble gene predicted promoter
                     /note="ble gene predicted promoter"
                     /regulatory_class="promoter"
     CDS             2149..2520
                     /label=BleoR
                     /note="antibiotic-binding protein"
     promoter        complement(2622..2640)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(2650..2666)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        2905..3009
                     /label=AmpR promoter
     promoter        3027..3055
                     /label=Pc promoter
                     /note="class 1 integron promoter"
     CDS             3244..3774
                     /label=GmR
                     /note="gentamycin acetyltransferase"
     regulatory      3937..3964
                     /label=putative antitoxin-toxin module-predicted promoter
                     /note="putative antitoxin-toxin module-predicted promoter"
                     /regulatory_class="promoter"
     CDS             3998..4291
                     /codon_start=1
                     /transl_table=11
                     /product="putative PaaA2-like antitoxin"
                     /label=putative PaaA2-like antitoxin
                     /note="putative component of an antitoxin-toxin system
                     involved in plasmid stability and maintenance"
                     /protein_id="QDL88250.1"
                     /translation="MTEATFTFRVDHDLKQEFSSLAKTVDRSGAQLIRDFMRDFVKKQQ
                     EAADYDKWFKQQVQIGLNEANAGKLIPHEDVKAEFAARRAATLAKLAAKNED"
     CDS             4281..4550
                     /codon_start=1
                     /transl_table=11
                     /product="putative ParE2-like toxin"
                     /label=putative ParE2-like toxin
                     /note="putative component of an antitoxin-toxin system
                     involved in plasmid stability and maintenance"
                     /protein_id="QDL88251.1"
                     /translation="MKIEWTETARQDRRNIYDYLEERNPIAAIEIDDLIEEKTDLLVDN
                     RLMGRTGRQKDTRELVIHPHYVVVYDITDIIRILRVLHTSQEWS"
     regulatory      4551..5522
                     /note="minimal origin of replication for Acinetobacter
                     spp."
                     /regulatory_class="replication_regulatory_region"