Cam_RbsR_TAN_LacI_KSL vector (V015914)

LOCUS       62056_466        5457 bp DNA     circular SYN 03-DEC-2019
DEFINITION  Cloning vector Cam_RbsR_TAN_LacI_KSL, complete sequence.
ACCESSION   MN207957
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5457)
  AUTHORS   Rondon RE, Groseclose TM, Short AE, Wilson CJ.
  TITLE     Transcriptional programming using engineered systems of 
            transcription factors and genetic architectures
  JOURNAL   Nat Commun 10 (1), 4784 (2019)
  PUBMED    31636266
REFERENCE   2  (bases 1 to 5457)
  AUTHORS   Rondon RE, Groseclose T, Short A, Wilson CJ.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUL-2019) Chemical and Biomolecular Engineering, 
            Georgia Institute of Technology, 950 Atlantic dr. NW, 5110E, 
            Atlanta, GA 30332, United States
REFERENCE   3  (bases 1 to 5457)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nat 
            Commun"; date: "2019"; volume: "10"; issue: "1"; pages: "4784"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (21-JUL-2019) Chemical and Biomolecular Engineering, Georgia 
            Institute of Technology, 950 Atlantic dr. NW, 5110E, Atlanta, GA 
            30332, United States"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..5457
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             complement(139..327)
                     /label=rop
                     /note="Rop protein, which maintains plasmids at low copy
                     number"
     CDS             complement(466..1545)
                     /label=lacI
                     /note="lac repressor"
     promoter        complement(1546..1623)
                     /label=lacIq promoter
                     /note="In the lacIq allele, a single base change in the
                     promoter boosts expression of the lacI gene about 10-fold."
     promoter        2324..2401
                     /label=lacI promoter
     CDS             2402..3400
                     /codon_start=1
                     /transl_table=11
                     /product="RbsR TAN"
                     /label=RbsR TAN
                     /protein_id="QFU95601.1"
                     /translation="MKPVTLYDVAEYAGVSTATVSNVVNQASHVSAKTREKVEAAMAEL
                     NYIPNRVAQQLAGKASHTIGMLITASTNPFYSELVRGVERSCFERGYSLVLCNTEGDEQ
                     RMNRNLETLMQKRVDGLLLLCTETHQPSREIMQRYPTVPTVMMDWAPFDGDSDLIQDNS
                     LLGGDLATQYLIDKGHTRIACITGPLDKTPARLRLEGYRAAMKRAGLNIPDGYEVTGDF
                     EFNGGFDAMRQLLSHPLRPQAVFTGNDAMAVGVYQALYQAELQVPQDIAVIGYDDIELA
                     SFMTPPLTTIHQPKDELGELAIDVLIHRITQPTLQQQRLQLTPILMERGSA"
     protein_bind    3413..3434
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      3625..4169
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     promoter        4695..4797
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     CDS             4798..5454
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"