pQGS vector (V015909)

LOCUS       62056_18680        9397 bp DNA     circular SYN 01-JAN-2019
DEFINITION  Cloning vector pQGS, complete sequence.
ACCESSION   MH423581
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9397)
  AUTHORS   Zhang X, Zheng H, Georgoulis SJ, Deatherage DE, Moran NA, Barrick 
            JE.
  TITLE     Evolution of small satellite plasmids stabilizes the maintenance of 
            newly acquired accessory genes in bacteria
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 9397)
  AUTHORS   Zhang X.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAY-2018) Molecular Biology, University of Texas at 
            Austin, 2500 Speedway A5000, Austin, TX 78712, USA
REFERENCE   3  (bases 1 to 9397)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (31-MAY-2018) Molecular Biology, University of Texas at Austin, 2500
            Speedway A5000, Austin, TX 78712, USA"
FEATURES             Location/Qualifiers
     source          1..9397
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      complement(437..831)
                     /direction=LEFT
                     /label=RSF1010 oriV
                     /note="replication origin of the broad-host-range plasmid 
                     RSF1010; requires the RSF1010 RepA/B/C proteins for 
                     replication (Scholz et al., 1989)"
     CDS             complement(858..1142)
                     /codon_start=1
                     /transl_table=11
                     /product="mobC protein"
                     /label=mobC protein
                     /protein_id="AXG25720.1"
                     /translation="MVKGSNKAADRLAKLEEQRARINAEIQRVRAREQQQERKNETRRK
                     VLVGAMILAKVNSSEWPEDRLMAAMDAYLERDHDRALFGLPPRQKDEPG"
     regulatory      1134..1164
                     /label=P1
                     /note="P1"
                     /regulatory_class="promoter"
     oriT            1173..1260
                     /label=RSF1010 oriT
                     /note="origin of transfer of the broad-host-range plasmid 
                     RSF1010 (Scholz et al., 1989)"
     CDS             2089..2502
                     /codon_start=1
                     /transl_table=11
                     /product="mobB protein"
                     /label=mobB protein
                     /protein_id="AXG25725.1"
                     /translation="MNAIDRVKKSRGINELAEQIEPLAQSMATLADEARQVMSQTQQAS
                     EAQAAEWLKAQRQTGAAWVELAKELREVAAEVSSAAQSARSASRGWHWKLWLTVMLASM
                     MPTVVLLIASLLLLDLTPLTTEDGSIWLRLVAR"
     CDS             2499..3467
                     /label=RSF1010 RepB
                     /note="replication protein B of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     regulatory      3472..3503
                     /label=P4 promoter
                     /note="P4 promoter"
                     /regulatory_class="promoter"
     CDS             3531..3743
                     /codon_start=1
                     /transl_table=11
                     /product="repE protein"
                     /label=repE protein
                     /protein_id="AXG25727.1"
                     /translation="MEYEKSASGSVYLIKSDKGYWLPGGFGYTSNKAEAGRFSVADMAS
                     LNLDGCTLSLFREDKPFGPGKFLGD"
     CDS             3745..3951
                     /codon_start=1
                     /transl_table=11
                     /product="repF protein"
                     /label=repF protein
                     /protein_id="AXG25719.1"
                     /translation="MKDQKDKQTGDLLASPDAVRQARYAERMKAKGMRQRKFWLTDDEY
                     EALRECLEELRAAQGGGSDPASA"
     CDS             3981..4817
                     /label=RSF1010 RepA
                     /note="replication protein A of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     CDS             4807..5655
                     /label=RSF1010 RepC
                     /note="replication protein C of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     regulatory      5685..5818
                     /label=specR
                     /note="specR"
                     /regulatory_class="promoter"
     CDS             6038..6826
                     /label=SmR
                     /note="aminoglycoside adenylyltransferase (Murphy, 1985)"
     CDS             6961..8040
                     /label=lacI
                     /note="lac repressor"
     terminator      8063..8111
                     /label=fd terminator
                     /note="central terminator from bacteriophage fd (Otsuka and
                     Kunisawa, 1982)"
     terminator      complement(8171..8214)
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     CDS             complement(8409..9122)
                     /label=yeGFP
                     /note="yeast-enhanced green fluorescent protein"
     regulatory      complement(9123..9218)
                     /label=gfp
                     /note="gfp"
                     /regulatory_class="promoter"