Basic Vector Information
- Vector Name:
- Integration-module-11-sequence
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8403 bp
- Type:
- Integration vector
- Replication origin:
- ori
- Source/Author:
- Castillo-Hair S, Baerman E, Fujita M, Igoshin O
Integration-module-11-sequence vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
Integration-module-11-sequence vector Sequence
LOCUS 62056_1340 8403 bp DNA circular SYN 29-JUL-2019
DEFINITION Integration vector Integration module 11 sequence.
ACCESSION MK995032
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 8403)
AUTHORS Castillo-Hair S, Baerman E, Fujita M, Igoshin O, Tabor J.
TITLE Optogenetic control of Bacillus subtilis gene expression
JOURNAL Nat Commun 10 (1), 3099 (2019)
PUBMED 31308373
REFERENCE 2 (bases 1 to 8403)
AUTHORS Castillo-Hair SM.
TITLE Direct Submission
JOURNAL Submitted (29-MAY-2019) Bioengineering, Rice University, 6100 Main
St., Houston, TX 77005, USA
REFERENCE 3 (bases 1 to 8403)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat
Commun"; date: "2019"; volume: "10"; issue: "1"; pages: "3099"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(29-MAY-2019) Bioengineering, Rice University, 6100 Main St.,
Houston, TX 77005, USA"
FEATURES Location/Qualifiers
source 1..8403
/mol_type="other DNA"
/organism="synthetic DNA construct"
gene 115..634
/pseudo
/gene="amyE"
/label=amyE
/note="alpha-amylase"
CDS complement(647..1360)
/label=superfolder GFP
/note="GFP variant that folds robustly even when fused to
poorly folded proteins (Pedelacq et al., 2006)"
regulatory complement(1361..1384)
/label=MF001
/note="MF001"
/regulatory_class="ribosome_binding_site"
regulatory complement(1385..1458)
/label=PrpsD
/note="PrpsD"
/regulatory_class="promoter"
regulatory 1400
/label=+1
/note="+1"
/regulatory_class="other"
regulatory complement(1408..1413)
/regulatory_class="minus_10_signal"
regulatory complement(1431..1436)
/regulatory_class="minus_35_signal"
gene 1765..2517
/gene="spc"
/label=spc
CDS 1765..2517
/codon_start=1
/transl_table=11
/gene="spc"
/product="spectinomycin resistance protein"
/label=spc
/protein_id="QDQ17183.1"
/translation="MNTYEQINKVKKILRKHLKNNLIGTYMFGSGVESGLKPNSDLDFL
VVVSEPLTDQSKEILIQKIRPISKKIGDKSNLRYIELTIIIQQEMVPWNHPPKQEFIYG
EWLQELYEQGYIPQKELNSDLTIMLYQAKRKNKRIYGNYDLEELLPDIPFSDVRRAIMD
SSEELIDNYQDDETNSILTLCRMILTMDTGKIIPKDIAGNAVAESSPLEHRERILLAVR
SYLGENIEWTNENVNLTINYLNNRLKKL"
misc_feature 2644..3833
/label=homology to PY79
/note="homology to PY79"
gene 2644..3669
/pseudo
/gene="amyE"
/label=amyE
/note="alpha-amylase"
CDS 5032..5763
/gene="ermC"
/label=ermC
/note="rRNA adenine N-6-methyltransferase from
Staphylococcus aureus. Accession#: P02979"
rep_origin complement(6574..7162)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(7336..8193)
/label=AmpR
/note="beta-lactamase"
promoter complement(8194..8298)
/label=AmpR promoter
This page is informational only.