pJF1150 vector (V015834)

LOCUS       V015834                 7661 bp    DNA     circular SYN 03-MAR-2019
DEFINITION  Exported.
ACCESSION   V015834
VERSION     V015834
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 7661)
  AUTHORS   Ruf S, Forner J, Hasse C, Kroop X, Seeger S, Schollbach L, Schadach
            A, Bock R.
  TITLE     High-efficiency generation of fertile transplastomic Arabidopsis
            plants
  JOURNAL   Nat Plants (2019) In press
   PUBMED   30778165
REFERENCE   2  (bases 1 to 7661)
  AUTHORS   Forner J, Hasse C, Ruf S, Bock R.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JUL-2018) Organelle Biology, Biotechnology and
            Molecular Ecophysiology, Max Planck Institute of Molecular Plant
            Physiology, Am Muehlenberg 1, Potsdam, Brandenburg D-14476, Germany
REFERENCE   3  (bases 1 to 7661)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName: "Nat Plants
            (2019) In press"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (06-JUL-2018) Organelle Biology, Biotechnology and Molecular
            Ecophysiology, Max Planck Institute of Molecular Plant Physiology,
            Am Muehlenberg 1, Potsdam, Brandenburg D-14476, Germany"
FEATURES             Location/Qualifiers
     source          1..7661
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     gene            1..521
                     /gene="psaB"
                     /label="psaB"
     CDS             1..521
                     /codon_start=3
                     /transl_table=11
                     /gene="psaB"
                     /product="PSAB"
                     /label="psaB"
                     /protein_id="QBG49738.1"
                     /translation="GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVS
                     QFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLVWATGFMFLIS
                     WRGYWQELIETLAWAHERTPLANLIRWKDKPVALSIVQARLVGLAHFSVGYIFTYAAFL
                     IASTSGKFG"
     CDS             656..955
                     /gene="rps14"
                     /label="Small ribosomal subunit protein uS14c"
                     /note="Small ribosomal subunit protein uS14c from
                     Arabidopsis thaliana. Accession#: P56804"
     tRNA            1119..1192
                     /product="tRNA-Met"
                     /label="trnfM"
                     /note="trnfM"
     regulatory      1302..1451
                     /label="Zea mays clpP promoter"
                     /note="Zea mays clpP promoter"
                     /regulatory_class="promoter"
     CDS             1453..2241
                     /label="SmR"
                     /note="aminoglycoside adenylyltransferase (Murphy, 1985)"
     terminator      2252..2338
                     /label="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      2430..2457
                     /label="rrnB T2 terminator"
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     regulatory      2475..2709
                     /label="Chlamydomonas reinhardtii psaA promoter"
                     /note="Chlamydomonas reinhardtii psaA promoter"
                     /regulatory_class="promoter"
     CDS             2711..3424
                     /label="mgfp5"
                     /note="GFP with folding enhancement mutations"
     regulatory      3428..3600
                     /label="Chlamydomonas reinhardtii atpB terminator"
                     /note="Chlamydomonas reinhardtii atpB terminator"
                     /regulatory_class="terminator"
     tRNA            complement(3664..3734)
                     /product="tRNA-Gly"
     CDS             complement(4288..4473)
                     /gene="psbZ"
                     /label="Photosystem II reaction center protein Z"
                     /note="Photosystem II reaction center protein Z from
                     Nicotiana tabacum. Accession#: P09974"
     promoter        complement(4812..4830)
                     /label="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(4840..4856)
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     rep_origin      4998..5453
                     /label="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        5479..5583
                     /label="AmpR promoter"
     CDS             5584..6441
                     /label="AmpR"
                     /note="beta-lactamase"
     rep_origin      6615..7203
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     protein_bind    7491..7512
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        7527..7557
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    7565..7581
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     7589..7605
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        7626..7644
                     /label="T3 promoter"
                     /note="promoter for bacteriophage T3 RNA polymerase"