Basic Vector Information
- Vector Name:
- pT7-NSP4(02V0002G3)
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3142 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Patzina-Mehling C, Falkenhagen A, Trojnar E, Gadicherla AK
pT7-NSP4(02V0002G3) vector Map
pT7-NSP4(02V0002G3) vector Sequence
LOCUS 62056_20790 3142 bp DNA circular SYN 15-DEC-2020
DEFINITION Cloning vector pT7-NSP4(02V0002G3), complete sequence.
ACCESSION MN689788
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3142)
AUTHORS Patzina-Mehling C, Falkenhagen A, Trojnar E, Gadicherla AK, Johne R.
TITLE Potential of avian and mammalian species A rotaviruses to reassort
as explored by plasmid only-based reverse genetics
JOURNAL Virus Res 286, 198027 (2020)
PUBMED 32442596
REFERENCE 2 (bases 1 to 3142)
AUTHORS Patzina-Mehling C, Falkenhagen A, Trojnar E, Gadicherla AK, Johne R.
TITLE Direct Submission
JOURNAL Submitted (13-NOV-2019) Unit Viruses in Food, German Federal
Institute for Risk Assessment, Diedersdorfer Weg 1, Berlin 12277,
Germany
REFERENCE 3 (bases 1 to 3142)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Virus Res
286, 198027 (2020)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(13-NOV-2019) Unit Viruses in Food, German Federal Institute for
Risk Assessment, Diedersdorfer Weg 1, Berlin 12277, Germany"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..3142
/mol_type="other DNA"
/organism="synthetic DNA construct"
primer_bind 6..22
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 233..251
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
5'UTR 250..289
gene 290..796
/gene="NSP4"
/label=NSP4
CDS 290..796
/codon_start=1
/transl_table=11
/gene="NSP4"
/product="NSP4"
/label=NSP4
/note="derived from Rotavirus A strain 02V0002G3"
/protein_id="QPP12457.1"
/translation="MENVTTINETLVEEVYNMTLGYFEHNVIIMKYFPFLASILTIIFT
AWKMGRSTLKMTKTVAGSGYKVIKVVVVTVFNCILRIFGSKTEIVSEDKMDVMASKILK
QIDEQVKVIEQLTKRELEQVKLLADIYELLKYKSEGNVPSETNRKAYETWSKDPYQPTR
AVSLN"
3'UTR 797..973
terminator 1134..1181
/label=T7 terminator
/note="transcription terminator for bacteriophage T7 RNA
polymerase"
primer_bind complement(1350..1366)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
terminator 1414..1445
/label=tonB terminator
/note="bidirectional E. coli tonB-P14 transcription
terminator"
promoter 1446..1548
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
CDS 1549..2406
/label=AmpR
/note="beta-lactamase"
terminator 2481..2508
/label=T7Te terminator
/note="phage T7 early transcription terminator"
rep_origin complement(2520..3107)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.