Basic Vector Information
- Vector Name:
- Cam_RbsR_TAN_CelR_KSL
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 5388 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Rondon RE, Groseclose TM, Short AE, Wilson CJ.
Cam_RbsR_TAN_CelR_KSL vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
Cam_RbsR_TAN_CelR_KSL vector Sequence
LOCUS 62056_461 5388 bp DNA circular SYN 03-DEC-2019
DEFINITION Cloning vector Cam_RbsR_TAN_CelR_KSL, complete sequence.
ACCESSION MN207955
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5388)
AUTHORS Rondon RE, Groseclose TM, Short AE, Wilson CJ.
TITLE Transcriptional programming using engineered systems of
transcription factors and genetic architectures
JOURNAL Nat Commun 10 (1), 4784 (2019)
PUBMED 31636266
REFERENCE 2 (bases 1 to 5388)
AUTHORS Rondon RE, Groseclose T, Short A, Wilson CJ.
TITLE Direct Submission
JOURNAL Submitted (21-JUL-2019) Chemical and Biomolecular Engineering,
Georgia Institute of Technology, 950 Atlantic dr. NW, 5110E,
Atlanta, GA 30332, United States
REFERENCE 3 (bases 1 to 5388)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat
Commun"; date: "2019"; volume: "10"; issue: "1"; pages: "4784"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(21-JUL-2019) Chemical and Biomolecular Engineering, Georgia
Institute of Technology, 950 Atlantic dr. NW, 5110E, Atlanta, GA
30332, United States"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..5388
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS complement(139..327)
/label=rop
/note="Rop protein, which maintains plasmids at low copy
number"
CDS complement(463..1476)
/codon_start=1
/transl_table=11
/product="CelR KSL"
/label=CelR KSL
/protein_id="QFU95592.1"
/translation="MKPVTLYDVAEYAGVSKSTVSLVVNQASHVSAKTREKVEAAIKEL
GYVPNRAARTLVTRRTDTVALVVSENNQKLFAEPFYAGIVLGVGVALSERGFQFVLATG
RSGIEHERLGGYLAGQHVDGVLLLSLHRDDPLPQMLDEAGVPYVYGGRPLGVPEEQVSY
VDIDNIGGGRQATQRLIETGHRRIATIAGPQDMVAGVERLQGYREALLAAGMEYDETLV
SYGDFTYDSGVAAMRELLDRAPDVDAVFAASDLMGLAALRVLRASGRRVPEDVAVVGYD
DSTVAEHAEPPMTSVNQPTELMGREMARLLVDRITGETTEPVRLVLETHLMVRESG"
promoter complement(1477..1554)
/label=lacIq promoter
/note="In the lacIq allele, a single base change in the
promoter boosts expression of the lacI gene about 10-fold."
promoter 2255..2332
/label=lacI promoter
CDS 2333..3331
/codon_start=1
/transl_table=11
/product="RbsR TAN"
/label=RbsR TAN
/protein_id="QFU95593.1"
/translation="MKPVTLYDVAEYAGVSTATVSNVVNQASHVSAKTREKVEAAMAEL
NYIPNRVAQQLAGKASHTIGMLITASTNPFYSELVRGVERSCFERGYSLVLCNTEGDEQ
RMNRNLETLMQKRVDGLLLLCTETHQPSREIMQRYPTVPTVMMDWAPFDGDSDLIQDNS
LLGGDLATQYLIDKGHTRIACITGPLDKTPARLRLEGYRAAMKRAGLNIPDGYEVTGDF
EFNGGFDAMRQLLSHPLRPQAVFTGNDAMAVGVYQALYQAELQVPQDIAVIGYDDIELA
SFMTPPLTTIHQPKDELGELAIDVLIHRITQPTLQQQRLQLTPILMERGSA"
protein_bind 3344..3365
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin 3556..4100
/label=p15A ori
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."
promoter 4626..4728
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
CDS 4729..5385
/label=CmR
/note="chloramphenicol acetyltransferase"
This page is informational only.