Basic Vector Information
- Vector Name:
- pUC19-ACMV
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6876 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Hoyer JS, Fondong VN, Dallas MM, Aimone CD
pUC19-ACMV vector Map
pUC19-ACMV vector Sequence
LOCUS 62056_21980 6876 bp DNA circular SYN 18-NOV-2020
DEFINITION Cloning vector pUC19 ACMV DNA-B 1.5mer, complete sequence.
ACCESSION MT856194
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6876)
AUTHORS Hoyer JS, Fondong VN, Dallas MM, Aimone CD, Deppong DO, Duffy S,
Hanley-Bowdoin L.
TITLE Deeply Sequenced Infectious Clones of Key Cassava Begomovirus
Isolates from Cameroon
JOURNAL Microbiol Resour Announc 9 (46), e00802-20 (2020)
PUBMED 33184153
REFERENCE 2 (bases 1 to 6876)
AUTHORS Hoyer JS, Fondong VN, Dallas MM, Aimone CD, Deppong DO, Duffy S,
Hanley-Bowdoin L.
TITLE Direct Submission
JOURNAL Submitted (06-AUG-2020) Ecology, Evolution, and Natural Resources,
Rutgers University, 14 College Farm Rd, New Brunswick, NJ 08901, USA
REFERENCE 3 (bases 1 to 6876)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Microbiol
Resour Announc"; date: "2020"; volume: "9"; issue: "46"; pages:
"e00802-20"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(06-AUG-2020) Ecology, Evolution, and Natural Resources, Rutgers
University, 14 College Farm Rd, New Brunswick, NJ 08901, USA"
COMMENT ##Assembly-Data-START##
Assembly Method :: Benchling v. 2019-01-22
Sequencing Technology :: Illumina; Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..6876
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin 171..759
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
protein_bind 1047..1068
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 1083..1113
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 1121..1137
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 1145..1161
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
misc_feature 1174..2656
/note="duplicated part of ACMV DNA-B partial tandem dimer,
HindIII to PstI inclusive, copy 1"
misc_feature 2558..5282
/label=ACMV DNA-B monomer unit, nick site to nick site
/note="ACMV DNA-B monomer unit, nick site to nick site"
misc_feature 2657..3898
/note="unique part of ACMV DNA-B partial tandem dimer, PstI
to HindIII, noninclusive"
gene 2992..3762
/gene="BV1"
/label=BV1
CDS 2992..3762
/codon_start=1
/transl_table=11
/gene="BV1"
/product="NSP"
/label=BV1
/protein_id="QNR00651.1"
/translation="MYSIRKQSRNLQRKYNSNTTNRYPIRRKYVAGHTRPCVRRRLSYE
PVERPLVHNVLCEKQHGDVFNLQQNTSYTSFVTYPARGSSGDGRSRDYIKLQSMSVSGV
IHAKADGNDDPMELSQVVNGVFVFSLIMDTKPYLPAGVQALPTFEELFGPYSACYVNLR
LLNNQQHRYRVLHSVKRFVSSSGDTKVSQFRFNKRLSTRRYTIWASFHDVDLVNAGGNY
RNISKNAILVSYAFVSEHAMSCKPFVQIETSYVG"
gene complement(3771..4667)
/gene="BC1"
/label=BC1
CDS complement(3771..4667)
/codon_start=1
/transl_table=11
/gene="BC1"
/product="MP"
/label=BC1
/protein_id="QNR00652.1"
/translation="MDTSVPVISSDYIHSARTEYKLTNDESPITLQFPSTLERTRVRIM
GKCMKVDHVVIEYRNQVPFNAQGSVIVTIRDTRLSDEQQDQAQFTFPIGCNVDLHYFSA
SYFSIDDNVPWQLLYKVEDSNVKNGITFAQIKAKLKLSAAKHSTDIKFKQPTIKILSKD
YGPDCVDFWSVGKPKPIRRLIQNEPGTDYDTGPKYRPITVQPGETWATKSTIGRSTSMR
YTGPQPIDIDASSSKQYASEAEFPLRGLHRLPEASLDPGDSVSQTQSMSKKDIESIIEQ
TVNKCLIAHRGSSHKDL"
misc_feature 3899..5381
/note="duplicated part of ACMV DNA-B partial tandem dimer,
HindIII to PstI inclusive, copy 2"
primer_bind complement(5421..5437)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 5911..6015
/label=AmpR promoter
CDS 6016..6873
/label=AmpR
/note="beta-lactamase"
This page is informational only.