Basic Vector Information
- Vector Name:
- pNRVL-caSAT1
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5220 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Nemeth T.
pNRVL-caSAT1 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNRVL-caSAT1 vector Sequence
LOCUS 62056_18220 5220 bp DNA circular SYN 03-MAR-2020 DEFINITION Cloning vector pNRVL-caSAT1, complete sequence. ACCESSION MN989861 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5220) AUTHORS Nemeth T. TITLE Direct Submission JOURNAL Submitted (24-JAN-2020) Department of Microbiology, University of Szeged, Kozep fasor 52, Szeged, Csongrad 6726, Hungary REFERENCE 2 (bases 1 to 5220) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (24-JAN-2020) Department of Microbiology, University of Szeged, Kozep fasor 52, Szeged, Csongrad 6726, Hungary" COMMENT ##Assembly-Data-START## Assembly Method :: CLC Genomics Workbench v. v11 Sequencing Technology :: IonTorrent ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5220 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(268..295) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(387..473) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 537..553 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 570..575 /label=StuI site for cassette release /note="StuI site for cassette release" misc_feature 576..1039 /note="site of recombination; CpNEUT5LUpup from C. parapsilosis" regulatory 1094..1591 /label=Candida albicans ACT1 promoter /note="Candida albicans ACT1 promoter" /regulatory_class="promoter" gene 1592..2818 /gene="caSAT1" /label=caSAT1 CDS join(1592..1601,2256..2818) /codon_start=1 /transl_table=11 /gene="caSAT1" /product="streptothricin acetyltransferase" /label=caSAT1 /note="codon-optimized for Candida albicans" /protein_id="QID92292.1" /translation="MDGEEVAALVIDNGSHMKISVIPEQVAETLDAENHFIVREVFDVH LSDQGFELSTRSVSPYRKDYISDDDSDEDSACYGAFIDQELVGKIELNSTWNDLASIEH IVVSHTHRGKGVAHSLIEFAKKWALSRQLLGIRLETQTNNVPACNLYAKCGFTLGGIDL FTYKTRPQVSNETAMYWYWFSGAQDDA" regulatory 2822..2951 /label=Candida albicans URA3 terminator /note="Candida albicans URA3 terminator" /regulatory_class="terminator" misc_feature 2979..2984 /label=BssHII site for insert ligation /note="BssHII site for insert ligation" misc_feature 2992..2997 /label=XhoI site for insert ligation /note="XhoI site for insert ligation" misc_feature 2998..3448 /note="site of recombination; CpNEUT5LDowndown from C. parapsilosis" misc_feature 3449..3454 /label=StuI site for cassette release /note="StuI site for cassette release" promoter complement(3462..3480) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(3485..3501) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 3614..4420 /label=KanR /note="aminoglycoside phosphotransferase" rep_origin 4570..5158 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.