pECpOE-GFP-L-RP10 vector (V015513)

LOCUS       V015513                 7777 bp    DNA     circular SYN 09-MAR-2020
DEFINITION  Exported.
ACCESSION   V015513
VERSION     V015513
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 7777)
  AUTHORS   Nemeth T.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2020) Department of Microbiology, University of
            Szeged, Kozep fasor 52, Szeged, Csongrad 6726, Hungary
REFERENCE   2  (bases 1 to 7777)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: CLC Genomics Workbench v. v11
            Sequencing Technology :: IonTorrent
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName: "Submitted
            (16-JAN-2020) Department of Microbiology, University of Szeged,
            Kozep fasor 52, Szeged, Csongrad 6726, Hungary"
            On Mar 9, 2020 this sequence version replaced MN956534.1.
FEATURES             Location/Qualifiers
     source          1..7777
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        24..128
                     /label="AmpR promoter"
     CDS             129..986
                     /label="AmpR"
                     /note="beta-lactamase"
     rep_origin      1160..1748
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     protein_bind    2036..2057
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        2072..2102
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    2110..2126
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     2134..2150
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        2171..2189
                     /label="T3 promoter"
                     /note="promoter for bacteriophage T3 RNA polymerase"
     regulatory      2222..3071
                     /label="Candida albicans TDH3 promoter"
                     /note="Candida albicans TDH3 promoter"
                     /regulatory_class="promoter"
     protein_bind    3078..3102
                     /label="attB1"
                     /note="recombination site for the Gateway(R) BP reaction"
     CDS             3103..3816
                     /label="yeGFP"
                     /note="yeast-enhanced green fluorescent protein"
     protein_bind    complement(3820..3844)
                     /label="attB2"
                     /note="recombination site for the Gateway(R) BP reaction"
     regulatory      3865..4105
                     /label="Saccharomyces cerevisiae URA3 terminator"
                     /note="Saccharomyces cerevisiae URA3 terminator"
                     /regulatory_class="terminator"
     gene            4126..4902
                     /gene="CPAR2_110290"
                     /label="CPAR2_110290"
     CDS             4126..4902
                     /codon_start=1
                     /transl_table=11
                     /gene="CPAR2_110290"
                     /product="ortholog of Candida albicans RPS1,
                     Uncharacterized in Candida parapsilosis"
                     /label="CPAR2_110290"
                     /note="recombination target"
                     /protein_id="QII68931.1"
                     /translation="MAVGKNKRLSKGKKGLKKKVVDPFTRKDWFDIKAPTTFENRNVGK
                     TLINRSTGLKNAADGLKGRVFEVCLADLQGSEDHSYRKIKLRVDEVQGKNLLTNFHGLD
                     FTSDKIRSRPLVRKWQSLVEANVTVKTADDYVLRVFAIAFTKRQPNQIKKTTYAQSSKL
                     REIRKKMTEIMQREVSNCTLAQLTSKLIPEVIGREIEKSTQTIFPLQNVHIRKVKLLKQ
                     PKFDLGSLLALHGEGSTEEKGKKVSGGFKDVVLESV"
     misc_feature    4500..4505
                     /gene="CPAR2_110290"
                     /label="StuI site for plasmid linearization"
                     /note="StuI site for plasmid linearization"
     CDS             complement(5130..6248)
                     /gene="LEU2"
                     /label="3-isopropylmalate dehydrogenase"
                     /note="3-isopropylmalate dehydrogenase from Candida
                     maltosa. Accession#: P07139"
     regulatory      complement(6249..7123)
                     /label="Candida maltosa LEU2 promoter"
                     /note="Candida maltosa LEU2 promoter"
                     /regulatory_class="promoter"
     promoter        complement(7138..7156)
                     /label="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(7163..7179)
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     rep_origin      complement(7320..7775)
                     /direction=LEFT
                     /label="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"