Basic Vector Information
- Vector Name:
- 3XFlag-SMXL6-no-EAR
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7289 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Wang L.
- Promoter:
- CaMV 35S
3XFlag-SMXL6-no-EAR vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
3XFlag-SMXL6-no-EAR vector Sequence
LOCUS 62056_126 7289 bp DNA circular SYN 20-JAN-2020 DEFINITION Cloning vector 3XFlag-SMXL6-no-EAR, complete sequence. ACCESSION MN780594 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7289) AUTHORS Wang L. TITLE Direct Submission JOURNAL Submitted (29-NOV-2019) State Key Laboratory of Plant Genomics, Institute of Genetics and Developmental Biology, CAS, West Beichen Road, Bei Jing 100101, China REFERENCE 2 (bases 1 to 7289) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (29-NOV-2019) State Key Laboratory of Plant Genomics, Institute of Genetics and Developmental Biology, CAS, West Beichen Road, Bei Jing 100101, China" FEATURES Location/Qualifiers source 1..7289 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 1..345 /label=CaMV 35S promoter /note="strong constitutive promoter from cauliflower mosaic virus" CDS 448..513 /label=3xFLAG /note="three tandem FLAG(R) epitope tags, followed by an enterokinase cleavage site" protein_bind 514..538 /label=attB1 /note="recombination site for the Gateway(R) BP reaction" CDS 541..3462 /codon_start=1 /transl_table=11 /product="AtSMXL6 no EAR" /label=AtSMXL6 no EAR /note="AtSMXL6 protein with EAR notif deletion" /protein_id="QHH26575.1" /translation="MPTPVTTARECLTEEAARALDDAVVVARRRSHAQTTSLHAVSALL AMPSSILREVCVSRAARSVPYSSRLQFRALELCVGVSLDRLPSSKSPATEEDPPVSNSL MAAIKRSQANQRRHPESYHLQQIHASNNGGGGCQTTVLKVELKYFILSILDDPIVNRVF GEAGFRSSEIKLDVLHPPVTQLSSRFSRGRCPPLFLCNLPNSDPNREFPFSGSSGFDEN SRRIGEVLGRKDKKNPLLIGNCANEALKTFTDSINSGKLGFLQMDISGLSLISIEKEIS EILADGSKNEEEIRMKVDDLGRTVEQSGSKSGIVLNLGELKVLTSEANAALEILVSKLS DLLKHESKQLSFIGCVSSNETYTKLIDRFPTIEKDWDLHVLPITASTKPSTQGVYPKSS LMGSFVPFGGFFSSTSNFRVPLSSTVNQTLSRCHLCNEKYLQEVAAVLKAGSSLSLADK CSEKLAPWLRAIETKEDKGITGSSKALDDANTSASQTAALQKKWDNICQSIHHTPAFPK LGFQSVSPQFPVQTEKSVRTPTSYLETPKLLNPPISKPKPMEDLTASVTNRTVSLPLSC VTTDFGLGVIYASKNQESKTTREKPMLVTLNSSLEHTYQKDFKSLREILSRKVAWQTEA VNAISQIICGCKTDSTRRNQASGIWLALLGPDKVGKKKVAMTLSEVFFGGKVNYICVDF GAEHCSLDDKFRGKTVVDYVTGELSRKPHSVVLLENVEKAEFPDQMRLSEAVSTGKIRD LHGRVISMKNVIVVVTSGIAKDNATDHVIKPVKFPEEQVLSARSWKLQIKLGDATKFGV NKRKYELETAQRAVKVQRSYVNETEFSPDHEAEDRDAWFDEFIEKVDGKVTFKPVDFDE LAKNIQEKIGSHFERCFGSETHLELDKEVILQILAASWSSLSSGEEEGRTIVDQWMQTV LARSFAEAKQKYGSNPMLGVKLVASSSGLASGVELPAKVDVIW" protein_bind complement(3464..3488) /label=attB2 /note="recombination site for the Gateway(R) BP reaction" promoter complement(3753..3771) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(3778..3794) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" rep_origin 3935..4390 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 4468..4572 /label=AmpR promoter CDS 4573..5430 /label=AmpR /note="beta-lactamase" rep_origin 5604..6192 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 6480..6501 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 6516..6546 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 6554..6570 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 6578..6594 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 6612..6630 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" promoter 6803..7289 /label=CaMV35S(long) /note="Cauliflower mosaic virus 35S promoter (long)"
This page is informational only.