Basic Vector Information
- Vector Name:
- 4-UBI-NPTII-PINII
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5780 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Gao H.
- Promoter:
- Ubi
4-UBI-NPTII-PINII vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
4-UBI-NPTII-PINII vector Sequence
LOCUS 62056_146 5780 bp DNA circular SYN 19-MAR-2020 DEFINITION Cloning vector 4-UBI:NPTII:PINII, complete sequence. ACCESSION MN294716 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5780) AUTHORS Gao H. TITLE Direct Submission JOURNAL Submitted (08-AUG-2019) Molecular Engineering in AST, Corteva Agriscience, 8305 NW 62nd Ave., Johnston, IA 50131, USA REFERENCE 2 (bases 1 to 5780) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (08-AUG-2019) Molecular Engineering in AST, Corteva Agriscience, 8305 NW 62nd Ave., Johnston, IA 50131, USA" COMMENT ##Assembly-Data-START## Assembly Method :: Vector NTI v. 10 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5780 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind complement(256..355) /label=attL2 /note="recombination site for the Gateway(R) LR reaction" promoter complement(373..391) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(396..412) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 525..1331 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 1481..2069 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(2399..2426) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(2518..2604) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 2668..2684 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind 2700..2799 /label=attL1 /note="recombination site for the Gateway(R) LR reaction" promoter 2834..4825 /label=Ubi promoter /note="maize polyubiquitin gene promoter" CDS 4850..5638 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase from Tn5" /translation="VEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRPV LFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLSS HLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQG LAPAELFARLKARMPDGDDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIAL ATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
This page is informational only.