Basic Vector Information
- Vector Name:
- pMS75
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5428 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Scheller L, Schmollack M, Bertschi A, Mansouri M
pMS75 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMS75 vector Sequence
LOCUS 62056_17285 5428 bp DNA circular SYN 30-JUN-2020 DEFINITION Cloning vector pMS75, complete sequence. ACCESSION MT267318 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5428) AUTHORS Scheller L, Schmollack M, Bertschi A, Mansouri M, Saxena P, Fussenegger M. TITLE Phosphoregulated orthogonal signal transduction in mammalian cells JOURNAL Nat Commun 11 (1), 3085 (2020) PUBMED 32555187 REFERENCE 2 (bases 1 to 5428) AUTHORS Scheller L. TITLE Direct Submission JOURNAL Submitted (29-MAR-2020) STI IBI-STI LPDI, EPFL, AI 3123 (Batiment AI), Station 19, Lausanne 1015, Switzerland REFERENCE 3 (bases 1 to 5428) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Commun"; date: "2020"; volume: "11"; issue: "1"; pages: "3085" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (29-MAR-2020) STI IBI-STI LPDI, EPFL, AI 3123 (Batiment AI), Station 19, Lausanne 1015, Switzerland" FEATURES Location/Qualifiers source 1..5428 /mol_type="other DNA" /organism="synthetic DNA construct" polyA_signal 46..179 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" primer_bind complement(216..232) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(240..256) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(264..294) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(309..330) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(618..1203) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(1377..2234) /label=AmpR /note="beta-lactamase" promoter complement(2235..2339) /label=AmpR promoter misc_feature 2408..2611 /label=SV40 early promoter /note="SV40 early promoter" promoter 2661..2679 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" misc_feature 2708..2713 /label=Kozak+ATG /note="Kozak+ATG" CDS 2711..3361 /codon_start=1 /transl_table=11 /product="truncated DcuS" /label=truncated DcuS /protein_id="QKE44357.1" /translation="MTSYADALRERSHEFMNKLHVILGLLHLKSYKQLEDYILKTANNY QEEIGSLLGKIKSPVIAGFLISKINRATDLGHTLILNSESQLPDSGSEDQVATLITTLG NLIENALEALGPEPGGEISVTLHYRHGWLHCEVNDDGPGIAPDKIDHIFDKGVSTKGSE RGVGLALVKQQVENLGGSIAVESEPGIFTQFFVQIPWDGERSNRASASGSTGV" misc_feature 2720..3331 /label=DucS 340+ /note="DucS 340+" polyA_signal 3398..3622 /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" rep_origin 3668..4096 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 4110..4439 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 4506..5297 /label=NeoR/KanR /note="aminoglycoside phosphotransferase"
This page is informational only.