pMS75 vector (V015321)

LOCUS       62056_17285        5428 bp DNA     circular SYN 30-JUN-2020
DEFINITION  Cloning vector pMS75, complete sequence.
ACCESSION   MT267318
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5428)
  AUTHORS   Scheller L, Schmollack M, Bertschi A, Mansouri M, Saxena P, 
            Fussenegger M.
  TITLE     Phosphoregulated orthogonal signal transduction in mammalian cells
  JOURNAL   Nat Commun 11 (1), 3085 (2020)
  PUBMED    32555187
REFERENCE   2  (bases 1 to 5428)
  AUTHORS   Scheller L.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-MAR-2020) STI IBI-STI LPDI, EPFL, AI 3123 (Batiment 
            AI), Station 19, Lausanne 1015, Switzerland
REFERENCE   3  (bases 1 to 5428)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nat 
            Commun"; date: "2020"; volume: "11"; issue: "1"; pages: "3085"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (29-MAR-2020) STI IBI-STI LPDI, EPFL, AI 3123 (Batiment AI), Station
            19, Lausanne 1015, Switzerland"
FEATURES             Location/Qualifiers
     source          1..5428
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     polyA_signal    46..179
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     primer_bind     complement(216..232)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(240..256)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(264..294)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(309..330)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(618..1203)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(1377..2234)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(2235..2339)
                     /label=AmpR promoter
     misc_feature    2408..2611
                     /label=SV40 early promoter
                     /note="SV40 early promoter"
     promoter        2661..2679
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     misc_feature    2708..2713
                     /label=Kozak+ATG
                     /note="Kozak+ATG"
     CDS             2711..3361
                     /codon_start=1
                     /transl_table=11
                     /product="truncated DcuS"
                     /label=truncated DcuS
                     /protein_id="QKE44357.1"
                     /translation="MTSYADALRERSHEFMNKLHVILGLLHLKSYKQLEDYILKTANNY
                     QEEIGSLLGKIKSPVIAGFLISKINRATDLGHTLILNSESQLPDSGSEDQVATLITTLG
                     NLIENALEALGPEPGGEISVTLHYRHGWLHCEVNDDGPGIAPDKIDHIFDKGVSTKGSE
                     RGVGLALVKQQVENLGGSIAVESEPGIFTQFFVQIPWDGERSNRASASGSTGV"
     misc_feature    2720..3331
                     /label=DucS 340+
                     /note="DucS 340+"
     polyA_signal    3398..3622
                     /label=bGH poly(A) signal
                     /note="bovine growth hormone polyadenylation signal"
     rep_origin      3668..4096
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        4110..4439
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     CDS             4506..5297
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"