Basic Vector Information
- Vector Name:
- pNR28.12
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8363 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Hammond TM, Rhoades NA.
- Promoter:
- trpC
pNR28.12 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNR28.12 vector Sequence
LOCUS 62056_18195 8363 bp DNA circular SYN 09-FEB-2019 DEFINITION Cloning vector pNR28.12, complete sequence. ACCESSION MH553564 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8363) AUTHORS Hammond TM, Rhoades NA. TITLE Identification of a genetic element required for spore killing in Neurospora JOURNAL Unpublished REFERENCE 2 (bases 1 to 8363) AUTHORS Hammond TM, Rhoades NA. TITLE Direct Submission JOURNAL Submitted (29-JUN-2018) School of Biological Sciences, Illinois State University, ISU School of Biological Sciences, Normal, IL 61790, USA REFERENCE 3 (bases 1 to 8363) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (29-JUN-2018) School of Biological Sciences, Illinois State University, ISU School of Biological Sciences, Normal, IL 61790, USA" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..8363 /mol_type="other DNA" /organism="synthetic DNA construct" CDS join(16..1864,1928..2124) /codon_start=1 /transl_table=11 /product="histone 3" /label=histone 3 /note="his-3" /protein_id="QBA09473.1" /translation="KLAISTILSSVWKSDRPDGLLPTVVVDEHDTALGLVYSSAESVNE ALRTQTGVYQSRKRGLWYKGATSGDTQELVRISLDCDNDALKFVVKQKGRFCHLDQSGC FGQLKGLPKLEQTLISRKQSAPEGSYTARLFSDEKLVRAKIMEEAEELCTAQTPQEIAF EAADLFYFALTRAVAAGVTLADIERSLDAKSWKVKRRTGDAKGKWAEKEGIKPAASALA ATSAPVTKEAAQETTPEKITMRRFDASKVSTEELDAALKRPAQKSSDAIYKIIVPIIED VRKNGDKAVLSYTHKFEKATSLTSPVLKAPFPKELMQLPEETIAAIDVSFENIRKFHAA QKEEKPLQVETMPGVVCSRFSRPIEAVGCYIPGGTAVLPSTALMLGVPAMVAGCNKIVF ASPPRADGTITPEIVHVAHKVGAESIVLAGGAQAVAAMAYGTESITKVDKILGPGNQFV TAAKMFVSNDTNAAVGIDMPAGPSEVLVIADKDANPAFVASDLLSQAEHGVDSQVILIA IDLDEEHLQAIEDEVHRQATELPRVQIVRGSIAHSITVQVKTVEEAMELSNKYAPEHLI LQIKEAEKAVDLVMNAGSVFIGAWTPESVGDYSAGVNHSLPTYGFGKQYSGVNFASFVK HITSSNLTAEGLKNVGQAVMQLAKVEELEAHRRAVSIRLEHMSKSN" promoter 2663..2681 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind 2714..2730 /label=SK primer /note="common sequencing primer, one of multiple similar variants" primer_bind complement(2764..2780) /label=KS primer /note="common sequencing primer, one of multiple similar variants" promoter 2801..3155 /label=trpC promoter /note="promoter for Aspergillus nidulans trpC" CDS 3159..3725 /label=NrsR /note="nourseothricin acetyltransferase" CDS 3758..3778 /codon_start=1 /transl_table=11 /product="TrpC" /label=TrpC /note="A. nidulans TrpC" /protein_id="QBA09472.1" /translation="AAKSAF" regulatory 3779..4317 /label=Aspergillus nidulans trpC terminator region /note="Aspergillus nidulans trpC terminator region" /regulatory_class="terminator" promoter complement(4340..4358) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" misc_feature 4360..5604 /note="Neurospora crassa intergenic spacer between his-3 and rat-1" CDS complement(5717..5728) /label=Factor Xa site /note="Factor Xa recognition and cleavage site" promoter complement(6003..6021) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" rep_origin complement(6279..6867) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(7041..7898) /label=AmpR /note="beta-lactamase" promoter complement(7899..8003) /label=AmpR promoter
This page is informational only.