Basic Vector Information
- Vector Name:
- pNiFty3-I-SEAP
- Antibiotic Resistance:
- Bleomycin
- Length:
- 4571 bp
- Type:
- Protein expression
- Replication origin:
- ori
- Host:
- Mammalian cells
- Selection Marker:
- Zeo
- Promoter:
- EF-1α core
- Growth Temperature:
- 30℃
pNiFty3-I-SEAP vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNiFty3-I-SEAP vector Sequence
LOCUS 62056_18030 4571 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4571) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..4571 /mol_type="other DNA" /organism="synthetic DNA construct" polyA_signal 1..49 /label=poly(A) signal /note="synthetic polyadenylation signal" misc_feature 60..151 /label=pause site /note="RNA polymerase II transcriptional pause signal from the human alpha-2 globin gene" CDS 636..2153 /codon_start=1 /label=SEAP /note="secreted alkaline phosphatase from human placenta" /translation="VLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAA KKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVALSKT YNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGK SVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVIL GGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLD PSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHG HHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGL APGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGED VAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPYTACDLAPPAGTTD" polyA_signal complement(2216..2337) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" polyA_signal complement(2437..2831) /label=beta-globin poly(A) /note="human beta-globin polyadenylation signal" CDS complement(2848..3219) /codon_start=1 /label=BleoR /note="antibiotic-binding protein" /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR EFALRDPAGNCVHFVAEEQD" promoter complement(3239..3286) /label=EM7 promoter /note="synthetic bacterial promoter" LTR complement(3316..3584) /label=5' LTR (truncated) /note="truncated 5' long terminal repeat (LTR) from human T-cell leukemia virus (HTLV) type 1" promoter complement(3597..3808) /label=EF-1-alpha core promoter /note="core promoter for human elongation factor EF-1-alpha" rep_origin complement(3876..4464) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.