Basic Vector Information
- Vector Name:
- pOm45-PS-GFP(S65T)-TEF1-Zeo
- Antibiotic Resistance:
- Bleomycin
- Length:
- 3218 bp
- Type:
- Protein expression
- Replication origin:
- ori
- Host:
- Yeast
- Selection Marker:
- Zeo
- Promoter:
- TEF1
- Growth Strain(s):
- DH5a
- Growth Temperature:
- 37℃
pOm45-PS-GFP(S65T)-TEF1-Zeo vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pOm45-PS-GFP(S65T)-TEF1-Zeo vector Sequence
LOCUS 62056_18285 3218 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3218) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..3218 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 130..377 /label=CYC1 terminator /note="transcription terminator for CYC1" rep_origin complement(452..1040) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 1302..2012 /codon_start=1 /label=GFP (S65T) /note="S65T variant of Aequorea victoria green fluorescent protein (Heim et al., 1995)" /translation="SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKF ICTTGKLPVPWPTLVTTFTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGN YKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVN FKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEF VTAAGITHGMDELYK" CDS 2020..2049 /codon_start=1 /label=Myc /note="Myc (human c-Myc proto-oncogene) epitope tag" /translation="EQKLISEEDL" CDS 2065..2082 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 2162..2408 /label=AOX1 terminator /note="transcription terminator for AOX1" promoter 2423..2834 /label=TEF1 promoter /note="promoter for EF-1-alpha" promoter 2842..2889 /label=EM7 promoter /note="synthetic bacterial promoter" CDS join(2908..3218,1..61) /codon_start=1 /label=BleoR /note="antibiotic-binding protein" /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR EFALRDPAGNCVHFVAEEQD"
This page is informational only.