Basic Vector Information
- Vector Name:
- pMW119
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4211 bp
- Type:
- Gene template
- Replication origin:
- pSC101 ori
- Host:
- E. coli
- Growth Strain(s):
- DH5a
- Growth Temperature:
- 30℃
pMW119 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMW119 vector Sequence
LOCUS 62056_17625 4211 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4211) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..4211 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 480..702 /label=pSC101 ori /note="low-copy replication origin that requires the Rep101 protein" CDS 750..1697 /codon_start=1 /label=Rep101 /note="RepA protein needed for replication with the pSC101 origin" /translation="MSELVVFKANELAISRYDLTEHETKLILCCVALLNPTIENPTRKE RTVSFTYNQYAQMMNISRENAYGVLAKATRELMTRTVEIRNPLVKGFEIFQWTNYAKFS SEKLELVFSEEILPYLFQLKKFIKYNLEHVKSFENKYSMRIYEWLLKELTQKKTHKANI EISLDEFKFMLMLENNYHEFKRLNQWVLKPISKDLNTYSNMKLVVDKRGRPTDTLIFQV ELDRQMDLVTELENNQIKMNGDKIPTTITSDSYLHNGLRKTLHDALTAKIQLTSFEAKF LSDMQSKHDLNGSFSWLTQKQRTTLENILAKYGRI" primer_bind 2264..2280 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 2281..2337 /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(2350..2366) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2374..2390) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2398..2428) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2443..2464) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(3144..4001) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(4002..4106) /label=AmpR promoter
This page is informational only.