Basic Vector Information
- Vector Name:
- pKR147
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4320 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- Rossger K, Charpin-El Hamri G, Fussenegger M.
pKR147 vector Map
pKR147 vector Sequence
LOCUS 40924_26974 4320 bp DNA circular SYN 18-DEC-2018
DEFINITION Mammalian expression vector pKR147, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4320)
AUTHORS Rossger K, Charpin-El Hamri G, Fussenegger M.
TITLE Reward-based hypertension control by a synthetic brain-dopamine
interface
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 110 (45), 18150-18155 (2013)
PUBMED 24127594
REFERENCE 2 (bases 1 to 4320)
AUTHORS Roessger K, Fussenegger M, Charpin-El-Hamri G.
TITLE Direct Submission
JOURNAL Submitted (09-AUG-2013) BSSE, ETH Zurich, Mattenstrasse 26, Basel,
BS 4058, Switzerland
REFERENCE 3 (bases 1 to 4320)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4320)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl.
Acad. Sci. U.S.A."; date: "2013"; volume: "110"; issue: "45"; pages:
"18150-18155"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(09-AUG-2013) BSSE, ETH Zurich, Mattenstrasse 26, Basel, BS 4058,
Switzerland"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4320
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS 23..976
/codon_start=1
/product="ANP-IgG"
/label=ANP-IgG
/note="extendin-4-furin cleavage site-ANP-linker-mIgG-Fc"
/protein_id="AHA35650.1"
/translation="MKIILWLCVFGLFLATLFPISWQMPVESGLSSEDSASSESFAKRI
KRSLRRSSCFGGRIDRIGAQSGLGCNSFRYRRGSGGSGGSGGSGGSGGRSGCKPCICTV
PEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPRE
EQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIP
PPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLN
VQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK"
polyA_signal complement(1016..1137)
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
rep_origin complement(1556..2144)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(2318..3175)
/label=AmpR
/note="beta-lactamase"
promoter complement(3176..3280)
/label=AmpR promoter
rep_origin 3307..3762
/direction=RIGHT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
polyA_signal 3893..3941
/label=poly(A) signal
/note="synthetic polyadenylation signal"
misc_feature 3955..4046
/label=pause site
/note="RNA polymerase II transcriptional pause signal from
the human alpha-2 globin gene"
regulatory 4080..4319
/label=CRE promoter
/note="CRE promoter"
/regulatory_class="promoter"
This page is informational only.