pkM225 vector (V005209)

MSDS

Basic Vector Information

- - Vector Name:
  - pkM225
- - Antibiotic Resistance:
  - Kanamycin
- - Length:
  - 6039 bp
- - Type:
  - Transposon vector
- - Replication origin:
  - ori
- - Source/Author:
  - Mertens K, Berg JP, Brennan RE, Weber MM, Chen C, Samuel JE.

pkM225 vector Vector Map

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pkM225 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_26889        6039 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Transposon vector pkM225, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6039)
  AUTHORS   Mertens K, Berg JP, Brennan RE, Weber MM, Chen C, Samuel JE.
  TITLE     Evolutionary Loss of katE as Balance Mechanism for Antioxidant Gene 
            Expression in Coxiella burnetii
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 6039)
  AUTHORS   Mertens K, Berg JP, Brennan RE, Weber MM, Chen C, Samuel JE.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-OCT-2010) Microbial and Molecular Pathogenesis, Texas 
            A
REFERENCE   3  (bases 1 to 6039)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6039)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (09-OCT-2010) Microbial and Molecular Pathogenesis, Texas A"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6039
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             329..1375
                     /codon_start=1
                     /product="transposase TnA7"
                     /label=transposase TnA7
                     /protein_id="ADQ57456.1"
                     /translation="MEKKEFRVLIKYCFLKGKNTVEAKTWLDNEFPDSAPGKSTIIDWY
                     AKFKRGEMSTEDGERSGRPKEVVTDENIKKIHKMILNDRKMKLIEIAEALKISKERVGH
                     IIHQYLDMRKLCAKWVPRELTFDQKQQRVDDSERCLQLLTRNTPEFFRRYVTMDETWLH
                     HYTPESNRQSAEWTATGEPSPKRGKTQKSAGKVMASVFWDAHGIIFIDYLEKGKTINSD
                     YYMALLERLKVEIAAKRPHMKKKKVLFHQDNAPCHKSLRTMAKIRELGFELLPHPPYSP
                     DLAPSDFFLFSDLKRMLAGKKFGCNEEVIAETEAYFEAKPKEYYRNGIKKLEGRYNRCI
                     ALEGNYVE"
     CDS             1749..2555
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     primer_bind     complement(2630..2646)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     repeat_region   2796..2822
                     /note="IR; inverted repeat"
     rep_origin      complement(2923..3511)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             4313..5020
                     /label=mCherry
                     /note="monomeric derivative of DsRed fluorescent protein
                     (Shaner et al., 2004)"
     CDS             5310..5966
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
     repeat_region   6011..6037
                     /note="IR; inverted repeat"

This page is informational only.