pKK30 vector (V005223)

LOCUS       V005223                 4040 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V005223
VERSION     V005223
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 4040)
  AUTHORS   Krute CN, Krausz KL, Markiewicz MA, Joyner JA, Pokhrel S, Hall PR,
            Bose JL.
  TITLE     Generation of a stable plasmid for in vitro and in vivo studies of
            Staphylococcus
  JOURNAL   Appl. Environ. Microbiol. (2016) In press
   PUBMED   27637878
REFERENCE   2  (bases 1 to 4040)
  AUTHORS   Krausz KL, Krute CN, Markiewicz MA, Bose JL.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2016) Microbiology, Molecular Genetics and
            Immunology, University of Kansas Medical Center, 3901 Rainbow Blvd,
            Kansas City, KS 66160, USA
REFERENCE   3  (bases 1 to 4040)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 4040)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
            Environ. Microbiol. (2016) In press"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (15-APR-2016) Microbiology, Molecular Genetics and Immunology,
            University of Kansas Medical Center, 3901 Rainbow Blvd, Kansas City,
            KS 66160, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4040
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             1..996
                     /codon_start=1
                     /gene="repF"
                     /product="RepF"
                     /label="repF"
                     /note="replication protein"
                     /protein_id="AOR52299.1"
                     /translation="MQYNTTRSITENQDNKTLKDMTKSGKQRPWREKKIDNVSYADILE
                     ILKIKKAFNVKQCGNILEFKPTDEGYLKLHKTWFCKSKLCPVCNWRRAMKNSYQAQKVI
                     EKVIKEKPKARWLFLTLSTKNAIDGDTLEQSLKHLTKAFDRLSRYKKVKQNLVGFMRST
                     EVTVNKNDGSYNQHMHVLLCVENAYFRKKENYITQEEWVNLWQRALQVDYRPVANVKAI
                     KPNRKGDKDIESAIKETSKYSVKSSDFLTDDDEKNQEIVSDLEKGLYRKRMLSYGGLLK
                     QKHKILNLDDVEDGNLINASDEDKTTDEEEKAHSITAIWNFEKQNYYLRH"
     gene            1..996
                     /gene="repF"
                     /label="repF"
     rep_origin      1179..1567
                     /label="R6K gamma ori"
                     /note="gamma replication origin from E. coli plasmid R6K;
                     requires the R6K initiator protein pi for replication"
     regulatory      1580..1824
                     /label="sarA P1 promoter"
                     /note="sarA P1 promoter"
                     /regulatory_class="promoter"
     CDS             1847..2329
                     /gene="dfrA"
                     /label="Dihydrofolate reductase type 1"
                     /note="Dihydrofolate reductase type 1 from Tn4003 from
                     Staphylococcus aureus. Accession#: P13955"
     regulatory      2340..2639
                     /label="blaZ transcription terminator"
                     /note="blaZ transcription terminator"
                     /regulatory_class="terminator"
     regulatory      2766..2823
                     /label="atl transcription terminator"
                     /note="atl transcription terminator"
                     /regulatory_class="terminator"
     rep_origin      3220..3397
                     /label="sso"
                     /note="sso"
     CDS             complement(3618..3629)
                     /label="WELQut site"
                     /note="WELQut protease recognition and cleavage site"
     rep_origin      3866..3886
                     /gene="dso"
     gene            3866..3886
                     /gene="dso"
                     /label="dso"