pJLIC vector (V005309)

LOCUS       40924_26231        7335 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pJLIC, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7335)
  AUTHORS   Trachtmann N, Alvarez Fong KF, Guitart Font E, Sprenger GA.
  TITLE     Construction of chromosomally encoded lacZ and gfp reporter strains 
            of Escherichia coli for global regulation of metabolism
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7335)
  AUTHORS   Trachtmann N, Alvarez Fong KF, Guitart Font E, Sprenger GA.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2016) Institute of microbiology, Stuttgart 
            university, Allmandring 31, Stuttgart 70569, Germany
REFERENCE   3  (bases 1 to 7335)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 7335)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (24-MAY-2016) Institute of microbiology, Stuttgart university, 
            Allmandring 31, Stuttgart 70569, Germany"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7335
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             6..179
                     /label=lacZ-alpha
                     /note="LacZ-alpha fragment of beta-galactosidase"
     regulatory      797..914
                     /label=5S terminator
                     /note="5S terminator"
                     /regulatory_class="terminator"
     terminator      917..1003
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      1095..1122
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     promoter        1141..1232
                     /label=AmpR promoter
     CDS             1233..2090
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      2264..2852
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    complement(3038..3178)
                     /label=bom
                     /note="basis of mobility region from pBR322"
     CDS             complement(3283..3471)
                     /label=rop
                     /note="Rop protein, which maintains plasmids at low copy
                     number"
     CDS             complement(4492..5571)
                     /label=lacI
                     /note="lac repressor"
     promoter        complement(5572..5649)
                     /label=lacIq promoter
                     /note="In the lacIq allele, a single base change in the
                     promoter boosts expression of the lacI gene about 10-fold."
     misc_feature    5754..6080
                     /label=flanking arm for integration region
                     /note="flanking arm for integration region"
     protein_bind    complement(6111..6158)
                     /label=FRT
                     /bound_moiety="FLP recombinase from the Saccharomyces
                     cerevisiae 2u plasmid"
                     /note="FLP-mediated recombination occurs in the 8-bp core 
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     CDS             complement(6194..6832)
                     /codon_start=1
                     /gene="cat"
                     /product="chloramphenicol acetyltransferase"
                     /function="chloramphenicol resistance"
                     /label=cat
                     /protein_id="APZ86789.1"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPELRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRCLMNTTVLR"
     gene            complement(6194..6832)
                     /gene="cat"
                     /label=cat
     promoter        complement(6833..6935)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     protein_bind    complement(7041..7074)
                     /label=FRT (minimal)
                     /note="supports FLP-mediated excision but not integration
                     (Turan and Bode, 2011)"
     promoter        7266..7294
                     /label=tac promoter
                     /note="strong E. coli promoter; hybrid between the trp and
                     lac UV5 promoters"
     protein_bind    7302..7318
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."