Basic Vector Information
- Vector Name:
- pJL71-2W-gpmcherry
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7279 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Scharschmidt TC, Rosenblum MD.
pJL71-2W-gpmcherry vector Map
pJL71-2W-gpmcherry vector Sequence
LOCUS V005310 7279 bp DNA circular SYN 18-DEC-2018
DEFINITION Exported.
ACCESSION V005310
VERSION V005310
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 7279)
AUTHORS Scharschmidt TC, Rosenblum MD.
TITLE A wave of regulatory T cells into neonatal skin mediates tolerance
to commensal microbes
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 7279)
AUTHORS Scharschmidt TC, Rosenblum MD.
TITLE Direct Submission
JOURNAL Submitted (30-OCT-2014) Dermatology, University of California San
Francisco, 513 Parnassus Ave, San Francisco, CA 94143, USA
REFERENCE 3 (bases 1 to 7279)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 7279)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(30-OCT-2014) Dermatology, University of California San Francisco,
513 Parnassus Ave, San Francisco, CA 94143, USA"
SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..7279
/mol_type="other DNA"
/organism="synthetic DNA construct"
regulatory 7..306
/regulatory_class="terminator"
CDS 2837..3568
/gene="ermC"
/label="rRNA adenine N-6-methyltransferase"
/note="rRNA adenine N-6-methyltransferase from
Staphylococcus aureus. Accession#: P02979"
promoter 3936..4040
/label="AmpR promoter"
CDS 4041..4898
/label="AmpR"
/note="beta-lactamase"
rep_origin 5072..5660
/direction=RIGHT
/label="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(5761..6165)
/codon_start=1
/product="ArgB"
/label="ArgB"
/protein_id="AKT95053.1"
/translation="MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQVLAKNIGKLIV
MYTIAYILNIFLFTLITNLTFYLIRRHAHGAHAPSSFWCYVESIILFILLPLVIVNFHI
NFLIMIILTVISLGVISVYAPSGRQLTQRR"
regulatory 5792..6479
/gene="agr"
/regulatory_class="promoter"
gene 5792..6479
/gene="agr"
/label="agr"
regulatory complement(6193..6198)
/gene="agr_P2"
/regulatory_class="minus_10_signal"
gene complement(6193..6198)
/gene="agr_P2"
/label="agr_P2"
regulatory complement(6216..6221)
/gene="agr-P2"
/regulatory_class="minus_35_signal"
gene complement(6216..6221)
/gene="agr-P2"
/label="agr-P2"
gene 6389..6417
/gene="agr-P3"
/label="agr-P3"
regulatory 6389..6394
/gene="agr-P3"
/regulatory_class="minus_35_signal"
regulatory 6412..6417
/gene="agr-P3"
/regulatory_class="minus_10_signal"
CDS 6570..7274
/label="mCherry"
/note="monomeric derivative of DsRed fluorescent protein
(Shaner et al., 2004)"
This page is informational only.