pJB785TTKm1 vector (V005366)

LOCUS       40924_25921        7682 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Promoter probe vector pJB785TTKm1, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7682)
  AUTHORS   Santos PM, Di Bartolo I, Blatny JM, Zennaro E, Valla S.
  TITLE     New broad-host-range promoter probe vectors based on the plasmid RK2
            replicon
  JOURNAL   FEMS Microbiol. Lett. 195 (1), 91-96 (2001)
  PUBMED    11167001
REFERENCE   2  (bases 1 to 7682)
  AUTHORS   Santos PM, Di Bartolo I, Blatny JM, Zennaro E, Valla S.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-NOV-2000) Biology, University of Rome 'Roma Tre', 
            Viale Marconi 446, Rome, RM 00146, Italy
REFERENCE   3  (bases 1 to 7682)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 7682)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "FEMS 
            Microbiol. Lett."; date: "2001"; volume: "195"; issue: "1"; pages: 
            "91-96"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (09-NOV-2000) Biology, University of Rome 'Roma Tre', Viale Marconi 
            446, Rome, RM 00146, Italy"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..7682
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     oriT            complement(67..175)
                     /direction=LEFT
                     /label=oriT
                     /note="incP origin of transfer"
     promoter        352..456
                     /label=AmpR promoter
     CDS             457..1314
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      1564..2094
                     /label=oriV
                     /note="incP origin of replication"
     regulatory      2316..2496
                     /label=Pneo
                     /note="Pneo"
                     /regulatory_class="promoter"
     CDS             2486..3631
                     /label=trfA
                     /note="trans-acting replication protein that binds to and 
                     activates oriV"
     CDS             4248..4946
                     /codon_start=1
                     /gene="kan"
                     /product="aminoglycoside-3'-phosphotransferase"
                     /label=kan
                     /note="confers kanamycin resistance"
                     /protein_id="AAK13425.1"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAAC"
     gene            4248..4946
                     /gene="kan"
                     /label=kan
     regulatory      5010..5476
                     /label=bidirectional
                     /note="bidirectional"
                     /regulatory_class="terminator"
     CDS             complement(5591..7240)
                     /label=luciferase
                     /note="firefly luciferase"
     terminator      complement(7258..7285)
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     terminator      complement(7377..7463)
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"