pJAK16-Blue vector (V005377)

LOCUS       V005377                12577 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V005377
VERSION     V005377
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 12577)
  AUTHORS   Kornacki JA.
  TITLE     A family of broad-host-range vectors for expression of cloned genes
            in Gram-negative bacteria
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 12577)
  AUTHORS   Xu K, Figurski DH.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JUL-2012) Microbiology and Immunology, Columbia
            University, 701W, 168th Street, Room 1514A, NYC, NY 10027, USA
REFERENCE   3  (bases 1 to 12577)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 12577)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (12-JUL-2012) Microbiology and Immunology, Columbia University,
            701W, 168th Street, Room 1514A, NYC, NY 10027, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..12577
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     terminator      121..207
                     /label="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      299..326
                     /label="rrnB T2 terminator"
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     promoter        345..436
                     /label="AmpR promoter"
     CDS             2218..2856
                     /gene="cmlA"
                     /label="Chloramphenicol acetyltransferase 2"
                     /note="Chloramphenicol acetyltransferase 2 from Escherichia
                     coli. Accession#: P22615"
     rep_origin      complement(5153..5547)
                     /direction=LEFT
                     /label="RSF1010 oriV"
                     /note="replication origin of the broad-host-range plasmid
                     RSF1010; requires the RSF1010 RepA/B/C proteins for
                     replication (Scholz et al., 1989)"
     oriT            5889..5976
                     /label="RSF1010 oriT"
                     /note="origin of transfer of the broad-host-range plasmid
                     RSF1010 (Scholz et al., 1989)"
     CDS             7215..8183
                     /label="RSF1010 RepB"
                     /note="replication protein B of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     CDS             8697..9533
                     /label="RSF1010 RepA"
                     /note="replication protein A of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     CDS             9523..10371
                     /label="RSF1010 RepC"
                     /note="replication protein C of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     regulatory      10535..10565
                     /label="P5 promoter"
                     /note="P5 promoter"
                     /regulatory_class="promoter"
     CDS             complement(10794..11609)
                     /codon_start=1
                     /product="LacI"
                     /label="LacI"
                     /note="represses the expression of downstream lacZ-alpha
                     gene and relives the repression when IPTG is added"
                     /protein_id="AFS32163.1"
                     /translation="MAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSR
                     ADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPA
                     LFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKY
                     LTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLR
                     VGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTTWTACCNSLRARR"
     promoter        complement(11733..11810)
                     /label="lacIq promoter"
                     /note="In the lacIq allele, a single base change in the
                     promoter boosts expression of the lacI gene about 10-fold."
     promoter        12040..12068
                     /label="tac promoter"
                     /note="strong E. coli promoter; hybrid between the trp and
                     lac UV5 promoters"
     protein_bind    12076..12092
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        12148..12166
                     /label="T3 promoter"
                     /note="promoter for bacteriophage T3 RNA polymerase"
     misc_feature    complement(12179..12286)
                     /label="MCS"
                     /note="pBluescript multiple cloning site"
     promoter        complement(12295..12313)
                     /label="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(12323..12339)
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     misc_feature    12528..12545
                     /note="pBAD_rev_primer; pTrcHis_rev_primer"