pJAK14-Blue vector (V005378)

LOCUS       40924_25866       11285 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pJAK14-Blue, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 11285)
  AUTHORS   Kornacki JA.
  TITLE     A family of broad-host-range vectors for expression of cloned genes 
            in Gram-negative bacteria
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 11285)
  AUTHORS   Xu K, Figurski DH.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JUL-2012) Microbiology and Immunology, Columbia 
            University, 701W, 168th Street, Room 1514A, NYC, NY 10027, USA
REFERENCE   3  (bases 1 to 11285)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 11285)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (12-JUL-2012) Microbiology and Immunology, Columbia University, 
            701W, 168th Street, Room 1514A, NYC, NY 10027, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..11285
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     terminator      121..207
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      299..326
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     promoter        345..436
                     /label=AmpR promoter
     CDS             1446..2237
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     rep_origin      complement(3861..4255)
                     /direction=LEFT
                     /label=RSF1010 oriV
                     /note="replication origin of the broad-host-range plasmid 
                     RSF1010; requires the RSF1010 RepA/B/C proteins for 
                     replication (Scholz et al., 1989)"
     oriT            4597..4684
                     /label=RSF1010 oriT
                     /note="origin of transfer of the broad-host-range plasmid 
                     RSF1010 (Scholz et al., 1989)"
     CDS             5923..6891
                     /label=RSF1010 RepB
                     /note="replication protein B of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     CDS             7405..8241
                     /label=RSF1010 RepA
                     /note="replication protein A of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     CDS             8231..9079
                     /label=RSF1010 RepC
                     /note="replication protein C of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     regulatory      9244..9274
                     /label=P5 promoter
                     /note="P5 promoter"
                     /regulatory_class="promoter"
     CDS             complement(9502..10317)
                     /codon_start=1
                     /product="LacI"
                     /label=LacI
                     /note="represses the expression of downstream lacZ-alpha
                     gene and relives the repression when IPTG is added"
                     /protein_id="AFS32161.1"
                     /translation="MAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSR
                     ADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPA
                     LFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKY
                     LTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLR
                     VGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTTWTACCNSLRARR"
     promoter        complement(10441..10518)
                     /label=lacIq promoter
                     /note="In the lacIq allele, a single base change in the
                     promoter boosts expression of the lacI gene about 10-fold."
     promoter        10748..10776
                     /label=tac promoter
                     /note="strong E. coli promoter; hybrid between the trp and
                     lac UV5 promoters"
     protein_bind    10784..10800
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        10856..10874
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     misc_feature    complement(10887..10994)
                     /label=MCS
                     /note="pBluescript multiple cloning site"
     promoter        complement(11003..11021)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(11031..11047)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    11237..11254
                     /note="pBAD_rev_primer; pTrcHis_rev_primer"