pJAH01 vector (V005380)

LOCUS       40924_25856        4753 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pJAH01, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4753)
  AUTHORS   Leeds JA, Beckwith J.
  TITLE     Lambda repressor N-terminal DNA-binding domain as an assay for 
            protein transmembrane segment interactions in vivo
  JOURNAL   J. Mol. Biol. 280 (5), 799-810 (1998)
  PUBMED    9671551
REFERENCE   2  (bases 1 to 4753)
  AUTHORS   Leeds JA, Beckwith J.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-1999) Microbiology, Harvard Medical School, 200 
            Longwood Avenue Bldg. D-1, Boston, MA 02115, USA
REFERENCE   3  (bases 1 to 4753)
  AUTHORS   Leeds JA.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-OCT-1999) Microbiology, Harvard Medical School, 200 
            Longwood Avenue Bldg. D-1, Boston, MA 02115, USA
REFERENCE   4  (bases 1 to 4753)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 4753)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J. Mol. 
            Biol."; date: "1998"; volume: "280"; issue: "5"; pages: "799-810"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (18-FEB-1999) Microbiology, Harvard Medical School, 200 Longwood 
            Avenue Bldg. D-1, Boston, MA 02115, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "Submitted 
            (20-OCT-1999) Microbiology, Harvard Medical School, 200 Longwood 
            Avenue Bldg. D-1, Boston, MA 02115, USA"
COMMENT     SGRef: number: 4; type: "Journal Article"
COMMENT     On Oct 20, 1999 this sequence version replaced AF129432.1.
FEATURES             Location/Qualifiers
     source          1..4753
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        29..59
                     /label=lac UV5 promoter
                     /note="E. coli lac promoter with an 'up' mutation"
     protein_bind    67..83
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     CDS             104..508
                     /codon_start=1
                     /gene="cI"
                     /product="lambda cI repressor"
                     /label=cI
                     /note="transcriptional repressor"
                     /protein_id="AAD31808.1"
                     /translation="MSTKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQ
                     SGVGALFNGINALNAYNAALLAKILKVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEY
                     PVFSHVQAGMFSPELRTFTKGDAERWVSTC"
     gene            104..508
                     /gene="cI"
                     /label=cI
     misc_feature    104..379
                     /gene="cI"
                     /label=Region: DNA-binding domain
                     /note="Region: DNA-binding domain"
     misc_feature    380..505
                     /gene="cI"
                     /label=Region: linker region
                     /note="Region: linker region"
     misc_feature    500..505
                     /gene="cI"
                     /label=AflIII restriction site
                     /note="AflIII restriction site"
     promoter        complement(728..830)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     rep_origin      complement(1356..1901)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     promoter        2013..2041
                     /label=tet promoter
                     /note="E. coli promoter for tetracycline efflux protein
                     gene"
     CDS             2089..3276
                     /codon_start=1
                     /label=TcR
                     /note="tetracycline efflux protein"
                     /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY
                     GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI
                     VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF
                     LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM
                     QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII
                     AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL
                     AALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST"