Basic Vector Information
- Vector Name:
- pISA417
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3851 bp
- Type:
- Bacterial expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
pISA417 vector Map
pISA417 vector Sequence
LOCUS 40924_25796 3851 bp DNA circular SYN 18-DEC-2018
DEFINITION Bacterial expression vector pISA417, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3851)
AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman
Fonseca M, Vanhoucke M, Beyaert R.
TITLE BCCM/LMBP Plasmid collection
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 3851)
AUTHORS De Schamphelaire W.
TITLE Direct Submission
JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent,
Technologiepark 927, 9052, BELGIUM
REFERENCE 3 (bases 1 to 3851)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 3851)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927,
9052, BELGIUM"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3851
/mol_type="other DNA"
/organism="synthetic DNA construct"
primer_bind 379..395
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
misc_feature complement(399..775)
/label=3' UTR of the cobA gene
/note="3' UTR of the cobA gene"
CDS complement(776..1549)
/codon_start=1
/note="unnamed protein product; cobA"
/protein_id="SJL88161.1"
/translation="MTTTLLPGTVTLVGAGPGDPELVTVAGLRAVQQAEVILYDRLAPQ
DLLSEASDDAELVPVGKIPRGHYVPQEEINQLLVAHAREGRKVVRLKGGDSFVFGRGGE
EWQACAEAGIPVRVIPGVSSATAGPALAGIPLTHRHLVQGFTVVSGHVSPSDERSEVPW
RQLAKDRLTLVILMGVAHMRDIAPELMAGGLPADTPVRVVSNASLASQESWRTTLGDAV
ADMDAHHVRPPALVVVGTLAGVDLSHPDHRAPSDH"
misc_feature complement(1550..1584)
/label=5' UTR of the cobA gene
/note="5' UTR of the cobA gene"
primer_bind complement(1630..1646)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(1654..1670)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(1678..1708)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(1723..1744)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(2032..2620)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(2794..3651)
/label=AmpR
/note="beta-lactamase"
promoter complement(3652..3756)
/label=AmpR promoter
This page is informational only.