pHR307a vector (V005506)

LOCUS       40924_24912       10725 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pHR307a, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 10725)
  AUTHORS   Mastick GS, McKay R, Oligino T, Donovan K, Lopez AJ.
  TITLE     Identification of target genes regulated by homeotic proteins in 
            Drosophila melanogaster through genetic selection of Ultrabithorax 
            protein-binding sites in yeast
  JOURNAL   Genetics 139 (1), 349-363 (1995)
  PUBMED    7705635
REFERENCE   2  (bases 1 to 10725)
  AUTHORS   Hollenbach AD, Ng S-S., Flynn AP.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2005) Genetics, Louisiana State University Health 
            Sciences Center, 533 Bolivar Street, New Orleans, LA 70119, USA
REFERENCE   3  (bases 1 to 10725)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 10725)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Genetics"; 
            date: "1995"; volume: "139"; issue: "1"; pages: "349-363"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (20-APR-2005) Genetics, Louisiana State University Health Sciences 
            Center, 533 Bolivar Street, New Orleans, LA 70119, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..10725
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    1..50
                     /label=multiple cloning site
                     /note="multiple cloning site"
     regulatory      51..360
                     /label=GAL1 minimal promoter
                     /note="GAL1 minimal promoter"
                     /regulatory_class="promoter"
     CDS             366..1025
                     /label=HIS3
                     /note="imidazoleglycerol-phosphate dehydratase, required
                     for histidine biosynthesis"
     3'UTR           1029..1944
                     /gene="HIS3"
     promoter        2738..2953
                     /label=URA3 promoter
     3'UTR           complement(3160..3848)
                     /gene="TRP1"
     rep_origin      3173..4009
                     /label=ARS1
                     /note="S. cerevisiae autonomously replicating sequence 
                     ARS1/ARS416"
     CDS             complement(3896..4522)
                     /codon_start=1
                     /gene="TRP1"
                     /product="TRP1"
                     /label=TRP1
                     /protein_id="AAY40260.1"
                     /translation="MSVINFTGSSGPLVKVCGLQSTEAAECALDSDADLLGIICVPNRK
                     RTIDPVIARKISSLVKAYKNSSGTPKYLVGVFRNQPKEDVLALVNDYGIDIVQLHGDES
                     WQEYQEFLGLPVIKRLVFPKDCNILLSAASQKPHSFIPLFDSEAGGTGELLDWNSISDW
                     VGRQESPESLHFMLAGGLTPENVGDALRLNGVIGVDVSGGGRQMV"
     promoter        complement(4523..4624)
                     /label=TRP1 promoter
     misc_feature    complement(6576..8436)
                     /label=CEN/ARS
                     /note="S. cerevisiae CEN4 centromere fused to the
                     autonomously replicating sequence ARS1/ARS416"
     misc_feature    8575..8715
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(8901..9489)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(9663..10520)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(10521..10625)
                     /label=AmpR promoter