Basic Vector Information
- Vector Name:
- pMON82053
- Antibiotic Resistance:
- Streptomycin
- Length:
- 9769 bp
- Type:
- Expression vector
- Replication origin:
- oriV
- Host:
- Plants
- Source/Author:
- Preuss SB, Meister R, Xu Q, Urwin CP, Tripodi FA, Screen SE, Anil VS, Zhu S, Morrell JA, Liu G, Ratcliffe OJ, Reuber TL, Khanna R, Goldman BS, Bell E, Ziegler TE, McClerren AL, Ruff TG, Petracek ME.
- Promoter:
- CaMV 35S
pMON82053 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMON82053 vector Sequence
LOCUS 40924_31220 9769 bp DNA circular SYN 18-DEC-2018
DEFINITION Expression vector pMON82053, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 9769)
AUTHORS Preuss SB, Meister R, Xu Q, Urwin CP, Tripodi FA, Screen SE, Anil
VS, Zhu S, Morrell JA, Liu G, Ratcliffe OJ, Reuber TL, Khanna R,
Goldman BS, Bell E, Ziegler TE, McClerren AL, Ruff TG, Petracek ME.
TITLE Expression of the Arabidopsis thaliana BBX32 Gene in Soybean
Increases Grain Yield
JOURNAL PLoS ONE 7 (2), E30717 (2012)
PUBMED 22363475
REFERENCE 2 (bases 1 to 9769)
AUTHORS Preuss SB.
TITLE Direct Submission
JOURNAL
REFERENCE 3 (bases 1 to 9769)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 9769)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE";
date: "2012"; volume: "7"; issue: "2"; pages: "E30717"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(27-JUL-2011) Yield "
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..9769
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 271..615
/label=CaMV 35S promoter
/note="strong constitutive promoter from cauliflower mosaic
virus"
3'UTR 688..1002
/label=derived from G. barbadense E6
/note="derived from G. barbadense E6"
misc_feature 1073..1097
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
misc_feature complement(1526..2414)
/label=derived from E. coli aadA
/note="derived from E. coli aadA"
CDS complement(1584..2372)
/codon_start=1
/gene="aadA"
/product="aminoglycoside adenylyltransferase (Murphy,
1985)"
/label=SmR
/note="confers resistance to spectinomycin and
streptomycin"
/translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"
rep_origin 2945..3533
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature complement(3719..3859)
/label=bom
/note="basis of mobility region from pBR322"
CDS complement(3964..4152)
/label=rop
/note="Rop protein, which maintains plasmids at low copy
number"
rep_origin 5420..6133
/label=oriV
/note="incP origin of replication"
misc_feature 6299..6323
/label=LB T-DNA repeat
/note="left border repeat from octopine Ach5 T-DNA"
regulatory 6624..7223
/label=derived from A. thaliana Act7
/note="derived from A. thaliana Act7"
/regulatory_class="promoter"
5'UTR 7224..7861
/label=derived from A. thaliana Act7
/note="derived from A. thaliana Act7"
CDS 7864..8091
/codon_start=1
/product="EPSPS CTP"
/label=EPSPS CTP
/note="derived from A. thaliana ShkG"
/protein_id="AEP17835.1"
/translation="MAQVSRICNGVQNPSLISNLSKSSQRKSPLSVSLKTQQHPRAYPI
SSSWGLKKSGMTLIGSELRPLKVMSSVSTAC"
CDS 8092..9456
/gene="aroA"
/label=aroA
/note="3-phosphoshikimate 1-carboxyvinyltransferase from
Agrobacterium sp. (strain CP4). Accession#: Q9R4E4"
terminator 9466..9718
/label=NOS terminator
/note="nopaline synthase terminator and poly(A) signal"
This page is informational only.