pMM25 vector (V004696)

MSDS

Basic Vector Information

Vector Name:: pMM25

Antibiotic Resistance:: Ampicillin

Length:: 4266 bp

Type:: Saccharomyces cerevisiae vector

Replication origin:: ori

Host:: Yeast

Source/Author:: Moscariello MM, Sutherland BM.

Promoter:: HIS3

pMM25 vector Vector Map

View Map in NovoBuilder

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pMM25 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_31135        4266 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Saccharomyces cerevisiae vector pMM25, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4266)
  AUTHORS   Moscariello MM, Sutherland BM.
  TITLE     Transferring linear DNA fragments in the yeast Saccharomyces 
            cerevisiae: A new in vivo eukaryotic system that reveals deleterious
            combinations of DNA cluster damage
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4266)
  AUTHORS   Moscariello MM, Sutherland BM.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-SEP-2009) Biology, Brookhaven National Laboratory, 50 
            Bell Avenue, Upton, NY 11973, USA
REFERENCE   3  (bases 1 to 4266)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 4266)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (22-SEP-2009) Biology, Brookhaven National Laboratory, 50 Bell 
            Avenue, Upton, NY 11973, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4266
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      complement(3..458)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     600..616
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        626..644
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     670..686
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     gene            713..1659
                     /gene="ADE2"
                     /label=ADE2
     regulatory      713..885
                     /gene="ADE2"
                     /regulatory_class="promoter"
     CDS             886..1659
                     /codon_start=1
                     /gene="ADE2"
                     /product="phosphoribosylaminoimidazole carboxylase"
                     /label=ADE2
                     /note="catalyzes a step in 'de novo' purine nucleotide 
                     biosynthetic pathway"
                     /protein_id="ACX71835.1"
                     /translation="MDSRTVGILGGGQLGRMIVEAANRLNIKTVILDAENSPAKQISNS
                     NDHVNGSFSNPLDIEKLAEKCDVLTIEIEHVDVPTLKNLQVKHPKLKIYPSPETIRLIQ
                     DKYIQKEHLIKNGIAVTQSVPVEQASETSLLNVGRDLGFPFVLKSRTLAYDGRGNFVVK
                     NKEMIPEALEVLKDRPLYAEKWAPFTKELAVMIVRSVNGLVFSYPIVETIHKDNICDLC
                     YAPARVPDSVQLKAKLLAENAIKSFPGCGIFGVEMF"
     promoter        1812..1999
                     /label=HIS3 promoter
     CDS             2000..2018
                     /codon_start=1
                     /gene="HIS3"
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /label=HIS3
                     /note="catalyzes the sixth step in histidine biosynthesis"
                     /protein_id="ACX71836.1"
                     /translation="MRQSRK"
     primer_bind     complement(2025..2041)
                     /label=SK primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        complement(2078..2096)
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(2117..2133)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(2141..2157)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(2165..2195)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(2210..2231)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(2519..3107)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(3281..4138)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(4139..4243)
                     /label=AmpR promoter

This page is informational only.