Basic Vector Information
- Vector Name:
- pMLS7
- Antibiotic Resistance:
- Trimethoprim
- Length:
- 6124 bp
- Type:
- Broad host range vector
- Replication origin:
- pBBR1 oriV
- Source/Author:
- Lefebre MD, Valvano MA.
pMLS7 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMLS7 vector Sequence
LOCUS 40924_31105 6124 bp DNA circular SYN 18-DEC-2018
DEFINITION Broad host range vector pMLS7, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6124)
AUTHORS Lefebre MD, Valvano MA.
TITLE Construction and evaluation of plasmid vectors optimized for
constitutive and regulated gene expression in Burkholderia cepacia
complex isolates
JOURNAL Appl. Environ. Microbiol. 68 (12), 5956-5964 (2002)
PUBMED 12450816
REFERENCE 2 (bases 1 to 6124)
AUTHORS Lefebre MD, Valvano MA.
TITLE Direct Submission
JOURNAL Submitted (15-MAY-2002) Microbiology and Immunology, University of
Western Ontario, Dental Sciences Building Rm 3000, London, ONT N6A
5C1, Canada
REFERENCE 3 (bases 1 to 6124)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 6124)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
Environ. Microbiol."; date: "2002"; volume: "68"; issue: "12";
pages: "5956-5964"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(15-MAY-2002) Microbiology and Immunology, University of Western
Ontario, Dental Sciences Building Rm 3000, London, ONT N6A 5C1,
Canada"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6124
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter complement(836..938)
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
CDS complement(1088..2107)
/codon_start=1
/gene="mob"
/product="Mob"
/function="required for plasmid mobilization"
/label=mob
/protein_id="AAM63386.1"
/translation="MAAYAIMRCKKLAKMGNVAASLKHAYRERETPNADASRTPENEHW
AASSTDEAMGRLRELLPEKRRKDAVLAVEYVMTASPEWWKSASQEQQAAFFEKAHKWLA
DKYGADRIVTASIHRDETSPHMTAFVVPLTQDGRLSAKEFIGNKAQMTRDQTTFAAAVA
DLGLQRGIEGSKARHTRIQAFYEALERPPVGHVTISPQAVEPRAYAPQGLAEKLGISKR
VETPEAVADRLTKAVRQGYEPALQAAAGAREMRKKADQAQETARDLRERLKPVLDALGP
LNRDMQAKAAAIIKAVGEKLLTEQREVQRQKQAQRQQERGRAHFPEKCHLTSKKPLLS"
gene complement(1088..2107)
/gene="mob"
/label=mob
rep_origin 2331..3100
/label=pBBR1 oriV
/note="replication origin of the broad-host-range plasmid
pBBR1 from Bordetella bronchiseptica; requires the pBBR1
Rep protein for replication"
CDS 3101..3760
/label=pBBR1 Rep
/note="replication protein for the broad-host-range plasmid
pBBR1 from Bordetella bronchiseptica"
CDS complement(4218..4451)
/label=TpR
/note="E. coli plasmid-associated dihydrofolate reductase"
promoter complement(4778..4806)
/gene="intI1 (promoter lies within the coding sequence)"
/label=Pc promoter
/note="class 1 integron promoter"
CDS 5069..5446
/gene="rpsL"
/label=rpsL
/note="Small ribosomal subunit protein uS12 from
Paraburkholderia xenovorans (strain LB400). Accession#:
Q13TG5"
misc_feature 5642..5697
/note="multiple cloning site; EcoRI to HindIII"
terminator 5900..5986
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
terminator 6078..6105
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
This page is informational only.