Basic Vector Information
- Vector Name:
- pME-lama4-NS
- Antibiotic Resistance:
- Kanamycin
- Length:
- 8158 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Sztal TE, Sonntag C, Hall TE, Currie PD.
pME-lama4-NS vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pME-lama4-NS vector Sequence
LOCUS 40924_30495 8158 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pME-lama4-NS, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 8158)
AUTHORS Sztal TE, Sonntag C, Hall TE, Currie PD.
TITLE Epistatic dissection of laminin-receptor interactions in dystrophic
zebrafish muscle
JOURNAL Hum. Mol. Genet. 21 (21), 4718-4731 (2012)
PUBMED 22859503
REFERENCE 2 (bases 1 to 8158)
AUTHORS Hall TE, Sztal TE, Currie PD.
TITLE Direct Submission
JOURNAL Submitted (21-JUN-2012) Institute for Molecular Bioscience,
University of Queensland, 306 Carmody Road, St Lucia, QLD 4067,
Australia
REFERENCE 3 (bases 1 to 8158)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 8158)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Hum. Mol.
Genet."; date: "2012"; volume: "21"; issue: "21"; pages: "4718-4731"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(21-JUN-2012) Institute for Molecular Bioscience, University of
Queensland, 306 Carmody Road, St Lucia, QLD 4067, Australia"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..8158
/mol_type="other DNA"
/organism="synthetic DNA construct"
terminator complement(268..295)
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
terminator complement(387..473)
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
primer_bind 537..553
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 569..668
/label=attL1
/note="recombination site for the Gateway(R) LR reaction"
misc_feature 669..6281
/label=similar to laminin alpha4 chain
/note="similar to laminin alpha4 chain"
protein_bind complement(6283..6382)
/label=attL2
/note="recombination site for the Gateway(R) LR reaction"
promoter complement(6400..6418)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind complement(6423..6439)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
CDS 6552..7358
/codon_start=1
/label=KanR
/note="aminoglycoside phosphotransferase"
/translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP
DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA
FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD
FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD
RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
rep_origin 7508..8096
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.