Basic Vector Information
- Vector Name:
- pME-lama4-NS
- Antibiotic Resistance:
- Kanamycin
- Length:
- 8158 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Sztal TE, Sonntag C, Hall TE, Currie PD.
pME-lama4-NS vector Map
pME-lama4-NS vector Sequence
LOCUS 40924_30495 8158 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pME-lama4-NS, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 8158)
AUTHORS Sztal TE, Sonntag C, Hall TE, Currie PD.
TITLE Epistatic dissection of laminin-receptor interactions in dystrophic
zebrafish muscle
JOURNAL Hum. Mol. Genet. 21 (21), 4718-4731 (2012)
PUBMED 22859503
REFERENCE 2 (bases 1 to 8158)
AUTHORS Hall TE, Sztal TE, Currie PD.
TITLE Direct Submission
JOURNAL Submitted (21-JUN-2012) Institute for Molecular Bioscience,
University of Queensland, 306 Carmody Road, St Lucia, QLD 4067,
Australia
REFERENCE 3 (bases 1 to 8158)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 8158)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Hum. Mol.
Genet."; date: "2012"; volume: "21"; issue: "21"; pages: "4718-4731"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(21-JUN-2012) Institute for Molecular Bioscience, University of
Queensland, 306 Carmody Road, St Lucia, QLD 4067, Australia"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..8158
/mol_type="other DNA"
/organism="synthetic DNA construct"
terminator complement(268..295)
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
terminator complement(387..473)
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
primer_bind 537..553
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 569..668
/label=attL1
/note="recombination site for the Gateway(R) LR reaction"
misc_feature 669..6281
/label=similar to laminin alpha4 chain
/note="similar to laminin alpha4 chain"
protein_bind complement(6283..6382)
/label=attL2
/note="recombination site for the Gateway(R) LR reaction"
promoter complement(6400..6418)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind complement(6423..6439)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
CDS 6552..7358
/codon_start=1
/label=KanR
/note="aminoglycoside phosphotransferase"
/translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP
DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA
FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD
FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD
RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
rep_origin 7508..8096
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.