Basic Vector Information
- Vector Name:
- pME-h2afv-EosFPtd
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4410 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Hall TE, Currie PD.
pME-h2afv-EosFPtd vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pME-h2afv-EosFPtd vector Sequence
LOCUS 40924_30470 4410 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pME-h2afv-EosFPtd, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4410) AUTHORS Hall TE, Currie PD. TITLE Direct Submission JOURNAL Submitted (27-SEP-2011) Australian Regenerative Medicine Institute, Monash University, Building 75, Melbourne, VIC 3800, Australia REFERENCE 2 (bases 1 to 4410) TITLE Direct Submission REFERENCE 3 (bases 1 to 4410) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (27-SEP-2011) Australian Regenerative Medicine Institute, Monash University, Building 75, Melbourne, VIC 3800, Australia" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..4410 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(268..295) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(387..473) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 537..553 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind 569..667 /label=attL1 /note="recombination site for the Gateway(R) LR reaction" CDS 674..1057 /gene="H2AZ2" /label=H2AZ2 /note="Histone H2A.V from Bos taurus. Accession#: Q32LA7" CDS 1067..1090 /label=FLAG /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" CDS 1130..1804 /label=EosFP /note="green-to-red photoswitchable fluorescent protein (Wiedenmann et al., 2004)" CDS 1847..2524 /codon_start=1 /product="green-to-red photoswitchable fluorescent protein (Wiedenmann et al., 2004)" /label=EosFP /translation="SAIKPDMKINLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKE GGPLPFAFDILTTAFHYGNRVFAEYPDHIQDYFKQSFPKGYSWERSLTFEDGGICIARN DITMEGDTFYNKVRFHGVNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIRMALLLE GNAHYRCDFRTTYKAKEKGVKLPGYHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDN ARR" protein_bind complement(2535..2634) /label=attL2 /note="recombination site for the Gateway(R) LR reaction" promoter complement(2652..2670) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(2675..2691) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 2804..3610 /label=KanR /note="aminoglycoside phosphotransferase" rep_origin 3760..4348 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.