Basic Vector Information
- Vector Name:
- pMD-TV
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6155 bp
- Type:
- Integration vector
- Replication origin:
- pSC101 ori
- Source/Author:
- Dharmasena MN, Hanisch BW, Wai TT, Kopecko DJ.
pMD-TV vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMD-TV vector Sequence
LOCUS 40924_30401 6155 bp DNA circular SYN 18-DEC-2018
DEFINITION Integration vector pMD-TV, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6155)
AUTHORS Dharmasena MN, Hanisch BW, Wai TT, Kopecko DJ.
TITLE Stable expression of Shigella sonnei form I O-polysaccharide genes
recombineered into the chromosome of live Salmonella oral vaccine
vector Ty21a
JOURNAL Int. J. Med. Microbiol. 303 (3), 105-113 (2013)
PUBMED 23474241
REFERENCE 2 (bases 1 to 6155)
AUTHORS Dharmasena MN, Hanisch BW, Wai TT, Kopecko DJ.
TITLE Direct Submission
JOURNAL Submitted (30-JUL-2012) Laboratory of Enteric and Sexually
Transmitted Diseases, FDA-CBER, Lincoln Drive, Bethesda, MD 20892,
USA
REFERENCE 3 (bases 1 to 6155)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 6155)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Int. J.
Med. Microbiol."; date: "2013"; volume: "303"; issue: "3"; pages:
"105-113"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(30-JUL-2012) Laboratory of Enteric and Sexually Transmitted
Diseases, FDA-CBER, Lincoln Drive, Bethesda, MD 20892, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Assembly Method :: Vertor NTI v. NTI
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..6155
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS 109..1173
/gene="vexA"
/label=vexA
/note="Vi polysaccharide export protein VexA/TviF from
Salmonella typhi. Accession#: Q04976"
rep_origin 1658..1880
/label=pSC101 ori
/note="low-copy replication origin that requires the Rep101
protein"
CDS 1928..2875
/label=Rep101
/note="RepA protein needed for replication with the pSC101
origin"
gene 3914..4420
/gene="tivD"
/label=tivD
CDS 3914..4417
/codon_start=1
/gene="tivD"
/product="TivD"
/label=tivD
/protein_id="AGH89392.1"
/translation="PFLIDLIANVMSITLSFQNASMNKLFEKECRNVATRALKYVRQKK
TEGRLDEALSVLISLKRIEPDVSRLMREYKQIIRLFNESRKDGGSTITSYEHLDYAKKL
LVFDSENAYALKYAALNAMHLRDYTQALQYWQRLEKVNGPTEPVTRQISTCITALQKNT
SGKS"
protein_bind complement(4444..4491)
/label=FRT
/bound_moiety="FLP recombinase from the Saccharomyces
cerevisiae 2u plasmid"
/note="FLP-mediated recombination occurs in the 8-bp core
sequence TCTAGAAA (Turan and Bode, 2011)."
CDS 4852..5643
/label=NeoR/KanR
/note="aminoglycoside phosphotransferase"
protein_bind complement(5837..5870)
/label=FRT (minimal)
/note="supports FLP-mediated excision but not integration
(Turan and Bode, 2011)"
This page is informational only.