Basic Vector Information
pSC101 ori is a low-copy replication origin that requires the Rep101 protein, which is a temperature-sensitive protein. When bacteria containing a plasmid with this ori is cultured at 37℃, the plasmid will be lost.
- Vector Name:
- pMD-TV
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6155 bp
- Type:
- Integration vector
- Replication origin:
- pSC101 ori
- Source/Author:
- Dharmasena MN, Hanisch BW, Wai TT, Kopecko DJ.
- Copy Number:
- Low Copy
- Growth Temperature:
- 30℃
pMD-TV vector Map
pMD-TV vector Sequence
LOCUS V004803 6155 bp DNA circular SYN 18-DEC-2018
DEFINITION Exported.
ACCESSION V004803
VERSION V004803
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 6155)
AUTHORS Dharmasena MN, Hanisch BW, Wai TT, Kopecko DJ.
TITLE Stable expression of Shigella sonnei form I O-polysaccharide genes
recombineered into the chromosome of live Salmonella oral vaccine
vector Ty21a
JOURNAL Int. J. Med. Microbiol. 303 (3), 105-113 (2013)
PUBMED 23474241
REFERENCE 2 (bases 1 to 6155)
AUTHORS Dharmasena MN, Hanisch BW, Wai TT, Kopecko DJ.
TITLE Direct Submission
JOURNAL Submitted (30-JUL-2012) Laboratory of Enteric and Sexually
Transmitted Diseases, FDA-CBER, Lincoln Drive, Bethesda, MD 20892,
USA
REFERENCE 3 (bases 1 to 6155)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 6155)
AUTHORS .
TITLE Direct Submission
COMMENT ##Assembly-Data-START##
Assembly Method :: Vertor NTI v. NTI
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
SGRef: number: 1; type: "Journal Article"; journalName: "Int. J.
Med. Microbiol."; date: "2013"; volume: "303"; issue: "3"; pages:
"105-113"
SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(30-JUL-2012) Laboratory of Enteric and Sexually Transmitted
Diseases, FDA-CBER, Lincoln Drive, Bethesda, MD 20892, USA"
SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6155
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS 109..1173
/gene="vexA"
/label="Vi polysaccharide export protein VexA/TviF"
/note="Vi polysaccharide export protein VexA/TviF from
Salmonella typhi. Accession#: Q04976"
rep_origin 1658..1880
/label="pSC101 ori"
/note="low-copy replication origin that requires the Rep101
protein"
CDS 1928..2875
/label="Rep101"
/note="RepA protein needed for replication with the pSC101
origin"
gene 3914..4420
/gene="tivD"
/label="tivD"
CDS 3914..4417
/codon_start=1
/gene="tivD"
/product="TivD"
/label="tivD"
/protein_id="AGH89392.1"
/translation="PFLIDLIANVMSITLSFQNASMNKLFEKECRNVATRALKYVRQKK
TEGRLDEALSVLISLKRIEPDVSRLMREYKQIIRLFNESRKDGGSTITSYEHLDYAKKL
LVFDSENAYALKYAALNAMHLRDYTQALQYWQRLEKVNGPTEPVTRQISTCITALQKNT
SGKS"
protein_bind complement(4444..4491)
/label="FRT"
/bound_moiety="FLP recombinase from the Saccharomyces
cerevisiae 2u plasmid"
/note="FLP-mediated recombination occurs in the 8-bp core
sequence TCTAGAAA (Turan and Bode, 2011)."
CDS 4852..5643
/label="NeoR/KanR"
/note="aminoglycoside phosphotransferase"
protein_bind complement(5837..5870)
/label="FRT (minimal)"
/note="supports FLP-mediated excision but not integration
(Turan and Bode, 2011)"
This page is informational only.