Basic Vector Information
- Vector Name:
- pMCS
- Antibiotic Resistance:
- Kanamycin
- Length:
- 12362 bp
- Type:
- Standard reference vector
- Replication origin:
- ori
- Source/Author:
- Xi J, Wang X, Dong L, Dong Y, Su Y, Tang Q, Wang Z.
- Promoter:
- CaMV35S(enhanced)
pMCS vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMCS vector Sequence
LOCUS 40924_30041 12362 bp DNA circular SYN 18-DEC-2018
DEFINITION Standard reference vector pMCS, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 12362)
AUTHORS Xi J, Wang X, Dong L, Dong Y, Su Y, Tang Q, Wang Z.
TITLE Construction of a standard reference plasmid containing seven target
genes for the detection of transgenic cotton
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 12362)
AUTHORS Xi J, Wang X, Dong L, Dong Y, Su Y, Tang Q, Wang Z.
TITLE Direct Submission
JOURNAL Submitted (14-APR-2014) Biosafet Lab, Biotechnology Research
Institute, No. 12 Zhongguancun South Street, Beijing 100081, China
REFERENCE 3 (bases 1 to 12362)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 12362)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(14-APR-2014) Biosafet Lab, Biotechnology Research Institute, No. 12
Zhongguancun South Street, Beijing 100081, China"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..12362
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS 1219..1845
/label=pVS1 StaA
/note="stability protein from the Pseudomonas plasmid pVS1
(Heeb et al., 2000)"
CDS 2282..3346
/label=pVS1 RepA
/note="replication protein from the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
rep_origin 3415..3609
/label=pVS1 oriV
/note="origin of replication for the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
misc_feature 3953..4093
/label=bom
/note="basis of mobility region from pBR322"
rep_origin complement(4279..4867)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(4957..5748)
/label=KanR
/note="aminoglycoside phosphotransferase"
misc_feature 6173..6197
/label=LB T-DNA repeat
/note="left border repeat from nopaline C58 T-DNA"
polyA_signal complement(6275..6449)
/label=CaMV poly(A) signal
/note="cauliflower mosaic virus polyadenylation signal"
CDS complement(6509..7297)
/label=NeoR/KanR
/note="aminoglycoside phosphotransferase"
promoter complement(7366..8043)
/label=CaMV 35S promoter (enhanced)
/note="cauliflower mosaic virus 35S promoter with a
duplicated enhancer region"
protein_bind 8234..8255
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 8270..8300
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 8308..8324
/label=lac operator
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 8332..8348
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
CDS 8364..8633
/codon_start=1
/gene="cptI"
/product="cowpea trypsin inhibitor"
/label=cptI
/protein_id="AII71483.1"
/translation="MRMDLKHLGSNHHDDSSDEPSESSEPCCDSCICTKSIPPQCHCTD
IRWNSCHSACKSCMCTRSMPGKCRCLDIADFCYKPCKSRDEDDE"
gene 8364..8633
/gene="cptI"
/label=cptI
CDS complement(8551..9579)
/codon_start=1
/gene="Cry1Ab/1Ac"
/product="Cry1Ab/Cry1Ac fusion protein"
/label=Cry1Ab/1Ac
/note="Bt protein"
/protein_id="AII71484.1"
/translation="NCLSNPEVVVLGGERIETGYTPIDISLSLTQFLLSEFVPGAGFVL
GPVDIIWGIFGPSQWDAFLVQIEQLINQRIEEFARNQAISRLEGLSNLYQIYAESFREW
EADPTNPALREEMRIQFNDMNSALTTAIPLFAVQNYQVPLLSVYVQAANLHLSVLRDVS
VFGQRWGFDAATINSRYNDLTRLIGNYTDHAVRWYNTGLERVWGPDSRDWIRYNQFRRE
LTLTVLDIVSLFPNYDSRTYPIRTVSQLTREIYTNPVLENFDGSFRGSAQGIEGSIRSP
HLMDILNSITIYTDAHRGEYYWSGHQIMASPVGFIIRRLRHEICTVCSRSPRCPGNGIY
PA"
gene complement(8551..9579)
/gene="Cry1Ab/1Ac"
/label=Cry1Ab/1Ac
CDS 9595..10959
/gene="aroA"
/label=aroA
/note="3-phosphoshikimate 1-carboxyvinyltransferase from
Agrobacterium sp. (strain CP4). Accession#: Q9R4E4"
regulatory 10963..11180
/label=NOS
/note="NOS"
/regulatory_class="terminator"
CDS join(11182..11296,11671..12064)
/codon_start=1
/gene="SadI"
/product="AE9 stearoyl-ACP desaturase"
/label=SadI
/note="from cotton K312"
/protein_id="AII71486.1"
/translation="STMPSPRNLRSSLALLFHQRPPLDLPSFP*SPPFLLAPKRLGI*K
SLSRLQRRCLFRSPTPCRLTRLRSLNLWRAGLRTTF*LTSNQLRNVGNPPTFFQILILM
DFMSKSKSLGKGQRRSQMITL*FWLVI*SPRKPFQLIKQCLIPWMELVMRQVLASLALA
VVLQRR"
gene 11182..12064
/gene="SadI"
/label=SadI
primer_bind complement(12038..12054)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
misc_feature 12257..12281
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
This page is informational only.