Basic Vector Information
- Vector Name:
- pMB-7
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6592 bp
- Type:
- Yeast expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
pMB-7 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMB-7 vector Sequence
LOCUS 40924_29861 6592 bp DNA circular SYN 18-DEC-2018 DEFINITION Yeast expression vector pMB-7, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6592) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 6592) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 6592) TITLE Direct Submission REFERENCE 4 (bases 1 to 6592) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6592 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 379..395 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS complement(625..1500) /codon_start=1 /note="unnamed protein product; Salmonella hisG" /protein_id="SJL88114.1" /translation="MLDNTRLRIAIQKSGRLSDDSRELLARCGIKINLHTQRLIAMAEN MPIDILRVRDDDIPGLVMDGVVDLGIIGENVLEEELLNRRAQGEDPRYLTLRRLDFGGC RLSLATPVDEAWDGPAALDGKRIATSYPHLLKRYLDQKGVSFKSCLLNGSVEVAPRAGL ADAICDLVSTGATLEANGLREVEVIYRSKACLIQRDGEMAQSKQELIDKLLTRIQGVIQ ARESKYIMMHAPSERLEEVIALLPGAERPTILPLAGEQQRVAMHMVSSETLFWETMDPR DNRVIDPWRN" CDS complement(2092..2901) /gene="URA3" /label=URA3 /note="Orotidine 5'-phosphate decarboxylase from Candida albicans (strain SC5314 / ATCC MYA-2876). Accession#: P13649" CDS complement(3370..4227) /codon_start=1 /note="unnamed protein product; Salmonella hisG" /protein_id="SJL88116.1" /translation="MLDNTRLRIAIQKSGRLSDDSRELLARCGIKINLHTQRLIAMAEN MPIDILRVRDDDIPGLVMDGVVDLGIIGENVLEEELLNRRAQGEDPRYLTLRRLDFGGC RLSLATPVDEAWDGPAALDGKRIATSYPHLLKRYLDQKGVSFKSCLLNGSVEVAPRAGL ADAICDLVSTGATLEANGLREVEVIYRSKACLIQRDGEMAQSKQELIDKLLTRIQGVIQ ARESKYIMMHAPSERLEEVIALLPGAERPTILPLAGEQQRVAMHMVSSETLFWETMDPL PCYP" primer_bind complement(4371..4387) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4395..4411) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4419..4449) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(4464..4485) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4773..5361) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5535..6392) /label=AmpR /note="beta-lactamase" promoter complement(6393..6497) /label=AmpR promoter
This page is informational only.