Basic Vector Information
- Vector Name:
- pLvCmvMYOCD2aHA
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9943 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- van Tuyn J, Sluiter JP, Swildens J, Goumans M-J., Doevendans PA, van der Laarse A, Schalij MJ, Atsma DE, de Vries AA.
- Promoter:
- RSV
pLvCmvMYOCD2aHA vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pLvCmvMYOCD2aHA vector Sequence
LOCUS 40924_28936 9943 bp DNA circular SYN 18-DEC-2018
DEFINITION Shuttle vector pLvCmvMYOCD2aHA, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 9943)
AUTHORS van Tuyn J, Sluiter JP, Swildens J, Goumans M-J., Doevendans PA, van
der Laarse A, Schalij MJ, Atsma DE, de Vries AA.
TITLE Gene expression profiling of myocardin-transduced human cardiac
progenitor cells
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 9943)
AUTHORS van Tuyn J.
TITLE Direct Submission
JOURNAL Submitted (25-JUN-2007) MCB, LUMC, Einthovenweg 20, Leiden, ZH
2333ZH, the Netherlands
REFERENCE 3 (bases 1 to 9943)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 9943)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(25-JUN-2007) MCB, LUMC, Einthovenweg 20, Leiden, ZH 2333ZH, the
Netherlands"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..9943
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 3..229
/label=RSV promoter
/note="Rous sarcoma virus enhancer/promoter"
repeat_region 212..410
LTR 230..410
/label=5' LTR (truncated)
/note="truncated 5' long terminal repeat (LTR) from HIV-1"
misc_feature 457..582
/label=HIV-1 Psi
/note="packaging signal of human immunodeficiency virus
type 1"
misc_feature 1075..1308
/label=RRE
/note="The Rev response element (RRE) of HIV-1 allows for
Rev-dependent mRNA export from the nucleus to the
cytoplasm."
CDS 1493..1537
/label=gp41 peptide
/note="antigenic peptide corresponding to amino acids 655
to 669 of the HIV envelope protein gp41 (Lutje Hulsik et
al., 2013)"
CDS 1686..1727
/note="Protein Tat from Human immunodeficiency virus type 1
group M subtype B (isolate WMJ22). Accession#: P12509"
misc_feature 1799..1916
/label=cPPT/CTS
/note="central polypurine tract and central termination
sequence of HIV-1"
enhancer 1939..2242
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
promoter 2243..2446
/label=CMV promoter
/note="human cytomegalovirus (CMV) immediate early
promoter"
CDS 2650..2775
/codon_start=1
/gene="MYOCD"
/product="truncated cardiac myocardin"
/label=MYOCD
/note="N-terminal region"
/protein_id="ABS20111.1"
/translation="MTLLGSEHSLLIRSKFRSVLQLRLQQRRTQEQLANQGIIPH"
CDS 5661..5687
/label=HA
/note="HA (human influenza hemagglutinin) epitope tag"
misc_feature 5730..6318
/label=WPRE
/note="woodchuck hepatitis virus posttranscriptional
regulatory element"
LTR 6457..6690
/label=3' LTR (Delta-U3)
/note="self-inactivating 3' long terminal repeat (LTR) from
HIV-1"
polyA_signal 6762..6896
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
rep_origin 6923..7058
/label=SV40 ori
/note="SV40 origin of replication"
promoter complement(7079..7097)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind complement(7107..7123)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
rep_origin 7268..7723
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 7752..7856
/label=AmpR promoter
CDS 7857..8714
/label=AmpR
/note="beta-lactamase"
rep_origin 8888..9476
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
protein_bind 9764..9785
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 9801..9831
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 9839..9855
/label=lac operator
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 9863..9879
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
promoter 9900..9918
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
This page is informational only.