Basic Vector Information
- Vector Name:
- pLvCmvMYOCD2aHA
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9943 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- van Tuyn J, Sluiter JP, Swildens J, Goumans M-J., Doevendans PA, van der Laarse A, Schalij MJ, Atsma DE, de Vries AA.
- Promoter:
- RSV
pLvCmvMYOCD2aHA vector Map
pLvCmvMYOCD2aHA vector Sequence
LOCUS V004903 9943 bp DNA circular SYN 18-DEC-2018
DEFINITION Exported.
ACCESSION V004903
VERSION V004903
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 9943)
AUTHORS van Tuyn J, Sluiter JP, Swildens J, Goumans M-J., Doevendans PA, van
der Laarse A, Schalij MJ, Atsma DE, de Vries AA.
TITLE Gene expression profiling of myocardin-transduced human cardiac
progenitor cells
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 9943)
AUTHORS van Tuyn J.
TITLE Direct Submission
JOURNAL Submitted (25-JUN-2007) MCB, LUMC, Einthovenweg 20, Leiden, ZH
2333ZH, the Netherlands
REFERENCE 3 (bases 1 to 9943)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 9943)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(25-JUN-2007) MCB, LUMC, Einthovenweg 20, Leiden, ZH 2333ZH, the
Netherlands"
SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..9943
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 3..229
/label="RSV promoter"
/note="Rous sarcoma virus enhancer/promoter"
repeat_region 212..410
LTR 230..410
/label="5' LTR (truncated)"
/note="truncated 5' long terminal repeat (LTR) from HIV-1"
misc_feature 457..582
/label="HIV-1 Psi"
/note="packaging signal of human immunodeficiency virus
type 1"
misc_feature 1075..1308
/label="RRE"
/note="The Rev response element (RRE) of HIV-1 allows for
Rev-dependent mRNA export from the nucleus to the
cytoplasm."
CDS 1493..1537
/label="gp41 peptide"
/note="antigenic peptide corresponding to amino acids 655
to 669 of the HIV envelope protein gp41 (Lutje Hulsik et
al., 2013)"
CDS 1686..1727
/note="Protein Tat from Human immunodeficiency virus type 1
group M subtype B (isolate WMJ22). Accession#: P12509"
/label="Protein Tat"
misc_feature 1799..1916
/label="cPPT/CTS"
/note="central polypurine tract and central termination
sequence of HIV-1"
enhancer 1939..2242
/label="CMV enhancer"
/note="human cytomegalovirus immediate early enhancer"
promoter 2243..2446
/label="CMV promoter"
/note="human cytomegalovirus (CMV) immediate early
promoter"
CDS 2650..2775
/codon_start=1
/gene="MYOCD"
/product="truncated cardiac myocardin"
/label="MYOCD"
/note="N-terminal region"
/protein_id="ABS20111.1"
/translation="MTLLGSEHSLLIRSKFRSVLQLRLQQRRTQEQLANQGIIPH"
CDS 5661..5687
/label="HA"
/note="HA (human influenza hemagglutinin) epitope tag"
misc_feature 5730..6318
/label="WPRE"
/note="woodchuck hepatitis virus posttranscriptional
regulatory element"
LTR 6457..6690
/label="3' LTR (Delta-U3)"
/note="self-inactivating 3' long terminal repeat (LTR) from
HIV-1"
polyA_signal 6762..6896
/label="SV40 poly(A) signal"
/note="SV40 polyadenylation signal"
rep_origin 6923..7058
/label="SV40 ori"
/note="SV40 origin of replication"
promoter complement(7079..7097)
/label="T7 promoter"
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind complement(7107..7123)
/label="M13 fwd"
/note="common sequencing primer, one of multiple similar
variants"
rep_origin 7268..7723
/label="f1 ori"
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 7752..7856
/label="AmpR promoter"
CDS 7857..8714
/label="AmpR"
/note="beta-lactamase"
rep_origin 8888..9476
/label="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
protein_bind 9764..9785
/label="CAP binding site"
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 9801..9831
/label="lac promoter"
/note="promoter for the E. coli lac operon"
protein_bind 9839..9855
/label="lac operator"
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 9863..9879
/label="M13 rev"
/note="common sequencing primer, one of multiple similar
variants"
promoter 9900..9918
/label="T3 promoter"
/note="promoter for bacteriophage T3 RNA polymerase"
This page is informational only.