pLT_88 vector (V004923)

MSDS Download GenBank File(.gb)

Basic Vector Information

pSC101 ori is a low-copy replication origin that requires the Rep101 protein, which is a temperature-sensitive protein. When bacteria containing a plasmid with this ori is cultured at 37℃, the plasmid will be lost.

Vector Name:: pLT_88

Antibiotic Resistance:: Ampicillin

Length:: 6400 bp

Type:: Cloning vector

Replication origin:: pSC101 ori

Source/Author:: Tian L.

Copy Number:: Low Copy

Growth Temperature:: 30℃

pLT_88 vector Map

Copy Sequence View Map

pLT_88 vector Sequence

LOCUS       V004923                 6400 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V004923
VERSION     V004923
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 6400)
  AUTHORS   Tian L.
  TITLE     Elucidation of the ethanol tolerance mechanism of Clostridium
            thermocellum by metabolome analysis
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 6400)
  AUTHORS   Tian L.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-JUL-2017) Thayer School of Engineering, Dartmouth
            College, 14 Engineering Dr, Hanover, NH 03755, USA
REFERENCE   3  (bases 1 to 6400)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6400)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (18-JUL-2017) Thayer School of Engineering, Dartmouth College, 14
            Engineering Dr, Hanover, NH 03755, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6400
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             1..1002
                     /label="repB"
                     /note="RepB replication protein"
     CDS             1281..2288
                     /codon_start=1
                     /gene="Gapdh"
                     /product="Gapdh"
                     /label="Gapdh"
                     /note="derived from Thermoanaerobacterium saccharolyticum"
                     /protein_id="AWT04834.1"
                     /translation="MAVKVGINGFGRIGRNFFRAALKKNVDLDIVAFNDLTDAKTLAHL
                     LKYDSTFGQFEGEVIAKEDSLVVNGKEIKILKETDPAKLPWKELGVDIVIESTGRFTNK
                     EDAVKHIEAGAKKVIISAPAKNEDITIVMGVNEDKYDPNAHHVISNASCTTNCLAPFAK
                     VLHNKFGIKRGLMTTVHSYTNDQRILDLPHKDLRRARSAAMSIIPTTTGAAKAVALVLP
                     ELKGKLNGFAMRVPTPDVSVVDLVAELEKSVTVEEVNAALKEAAENELKGILGYTDEPL
                     VSMDFKGDSRSSIVDGLSTMVMEGNMVKVVSWYDNEWGYSNRVVDLAKYVADRL"
     gene            1281..2288
                     /gene="Gapdh"
                     /label="Gapdh"
     CDS             2430..3077
                     /gene="cat"
                     /label="Chloramphenicol acetyltransferase"
                     /note="Chloramphenicol acetyltransferase from
                     Staphylococcus aureus. Accession#: P00485"
     CDS             complement(3161..4018)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(4019..4110)
                     /label="AmpR promoter"
     rep_origin      4869..5091
                     /label="pSC101 ori"
                     /note="low-copy replication origin that requires the Rep101
                     protein"
     CDS             5139..6086
                     /label="Rep101"
                     /note="RepA protein needed for replication with the pSC101
                     origin"

This page is informational only.